KEGG   Helicobacter pylori F32: HPF32_0485Help
Entry
HPF32_0485        CDS       T01911                                 

Definition
(GenBank) Type II restriction enzyme
Organism
heq  Helicobacter pylori F32
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RE_R_Pab1
Motif
Other DBs
NCBI-ProteinID: BAJ58067
UniProt: E6NNZ1
Position
518484..519239
Genome map
AA seq 251 aa AA seqDB search
MSLIKVSGDKKAIEVSIPLTSISGKVRVKIRHAFSDYGVSTATRKIPFSLKHYVEWQIGY
DVPIKDKEKFELTTLKDKKYHFLGANNKVKTLYELSEIIYYAKQLDLISLENLENTLKYL
EKQKQFIEDNFMITRERFKSHQFGGMDFELSHISYPLLIHFFNDNELSEIVIREQQYGSK
TQAMLYFCFSILELKTATPLLNRTATPKEHALLIIHKTNALMFLEMLKIFGLLSQAHHSD
VLKILEKILQN
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
gtgagtttgattaaagttagtggtgataaaaaagcgattgaggtttctattcccttaact
tcaatttcaggtaaagtgcgtgtgaaaatcagacatgcctttagcgattatggtgtttca
acagcgactagaaaaatcccttttagtttaaagcattatgtagagtggcaaatcggttat
gatgtccccattaaagataaagaaaaatttgaactcactactttaaaagataaaaaatat
cattttttaggggctaataataaagtaaaaactctttatgaattgagcgagattatttac
tatgccaagcaattagatttaatcagtttagaaaatttagaaaatactttaaaatattta
gaaaaacaaaaacaatttatagaagataattttatgattacaagagaaagatttaaatcg
catcaatttggtggcatggattttgaactttcacacatttcttatcccttactcattcat
ttttttaatgataatgagttgagcgaaatagttattagagagcaacaatatggttctaaa
acccaagccatgctgtatttttgcttttctattttggagttaaaaaccgctaccccctta
ttaaacagaacggctacgcccaaagaacatgctcttttgattatccataaaaccaacgct
ctcatgtttttagaaatgcttaaaatttttggacttttaagccaagcgcaccatagcgat
gtgttaaagattttagaaaaaatacttcaaaattaa

DBGET integrated database retrieval system