KEGG   Helicobacter pylori F32: HPF32_0487Help
Entry
HPF32_0487        CDS       T01911                                 

Definition
(GenBank) hypothetical protein
  KO
K08077  UDP-sugar diphosphatase [EC:3.6.1.45]
Organism
heq  Helicobacter pylori F32
Brite
Enzymes [BR:heq01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.45  UDP-sugar diphosphatase
     HPF32_0487
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: BAJ58069
UniProt: E6NNZ3
Position
520650..521288
Genome map
AA seq 212 aa AA seqDB search
MPYFKNAFNQKSLIDDSSVYLEPCSSSNFIELKRMHYNEENTKKTWDIIKSLDSVAVLLY
EKESDCFVIVKQFRPAIYARRFHFKRDQDQNIDGYTYELCAGLVDKANKSLEEIVCEEAL
EECGYQISPKNLETIGQFYSATGLSGSLQTLYYAEVCTHLKVSKGGGIDTEKIEVLFLKR
SKALDFIMDFQYAKTTGLSLAILWHLKKFKNV
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgccttattttaagaatgctttcaatcaaaaatctttaatagatgattctagtgtgtat
ttagagccttgttctagctctaatttcatagaattaaaacgcatgcattataatgaagag
aatactaagaaaacatgggatattattaagtctttagacagcgtggcggttttactctat
gaaaaagaatccgattgttttgtgattgtgaaacaattccgcccagccatttatgcgcgc
cgttttcattttaagcgcgatcaagatcaaaatattgacggatacacttatgaattgtgt
gcggggcttgtggataaagctaataagagtttagaagaaatcgtttgcgaagaagcgcta
gaagaatgcggttatcagatcagccctaaaaatttagaaaccataggccaattttatagc
gcgactgggctgagcgggagtttgcaaacgctctattacgctgaagtgtgcacgcatttg
aaagtttcaaagggtggggggattgatacagaaaagattgaagtgctgtttttgaagcga
tcaaaagctcttgattttataatggattttcaatacgctaaaaccaccggattgtcttta
gccattttatggcatttaaaaaagtttaaaaatgtttaa

DBGET integrated database retrieval system