KEGG   Helicobacter pylori F32: HPF32_0494Help
Entry
HPF32_0494        CDS       T01911                                 

Gene name
rplI
Definition
(GenBank) 50S ribosomal protein L9
  KO
K02939  
large subunit ribosomal protein L9
Organism
heq  Helicobacter pylori F32
Pathway
Ribosome
Module
Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:heq00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    HPF32_0494 (rplI)
Ribosome [BR:heq03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Large subunit
    HPF32_0494 (rplI)
  Bacteria
    HPF32_0494 (rplI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
529335..529784
Genome map
AA seq 149 aa AA seqDB search
MKVLLLEDVKNLGKAGEVCEVKDGYGNNFLIANKKAKLATNEVINKYKAEVKKKAEKEAL
EKAQKLQMVETLQAITLTIHKKVGANGSLFGAITKEEITERLKEQHANLDLDKKDIELKH
PIKSTGIYEIEVKLGSGVVGAFKIDVVAE
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atgaaggttctattactagaagatgtgaaaaatttgggcaaagcaggtgaagtgtgtgag
gttaaagacggctatgggaataactttttaatcgctaacaaaaaagctaaactcgccact
aacgaagtgatcaacaaatacaaagccgaagttaaaaagaaagctgaaaaagaagcccta
gaaaaggcacaaaaattacaaatggtagaaaccttacaagccatcacgctgactatccat
aaaaaagtcggcgcgaatggctctttatttggagcgatcactaaagaagagatcacagag
cgtttgaaagaacagcatgcgaatttggatttagataaaaaagacattgaactcaaacac
ccgattaaaagcacagggatttatgagattgaagtcaagcttggatctggggttgtgggc
gcgtttaaaattgatgtggtggctgagtag

DBGET integrated database retrieval system