KEGG   Helicobacter pylori F32: HPF32_0504Help
Entry
HPF32_0504        CDS       T01911                                 

Gene name
virB11-2
Definition
(GenBank) cag pathogenicity island protein
  KO
K03196  
type IV secretion system protein VirB11
Organism
heq  Helicobacter pylori F32
Pathway
Bacterial secretion system
Module
Helicobacter pylori pathogenicity signature, cagA pathogenicity island
Brite
KEGG Orthology (KO) [BR:heq00001]
 Environmental Information Processing
  Membrane transport
   03070 Bacterial secretion system
    HPF32_0504 (virB11-2)
Secretion system [BR:heq02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein [MD:M00333]
   HPF32_0504 (virB11-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(539712..540704)
Genome map
AA seq 330 aa AA seqDB search
MTEDRLSAEDKKFLEVERALKEAALNPLRHATEELFGDFLKMENITEICYNGNKVVWVLK
NNGEWQPFDVRDKKAFSLSRLMHFARCCASFKKKTIDNYENPILSSNLANGERVQIVLSP
VTVNDETISISIRIPSKTTYPHSFFEEQGFYNLLDNKEQAISAIKDGIAIGKNVIVCGGT
GSGKTTYIKSIMEFIPKEERIISIEDTEEIVFKHHKNYTQLFFGGNITSADCLKSCLRMR
PDRIILGELRSSEAYDFYNVLCSGHKGTLTTLHAGSSEEAFIRLANMSSSNNAARNIKFE
SLIEGFKDLIDMIVHINHHKQCDEFYIKHR
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgactgaagacagattgagtgcagaagataaaaaatttctagaagtagaaagagcttta
aaagaagcggcattaaatcctctaaggcatgctactgaagagctttttggtgatttttta
aaaatggaaaatatcactgagatttgttacaatgggaacaaggttgtatgggttttaaaa
aataatggcgaatggcaaccatttgatgtgagagacaagaaagcctttagtttatctcgt
ttaatgcattttgctcggtgctgtgcaagttttaagaaaaaaacaatagacaactatgaa
aatcctattttaagcagcaatttagcgaatggtgaaagggtgcagattgtcctttcccct
gttacagttaatgatgaaaccatttccatatccataaggatacctagcaaaacaacctat
cctcatagcttctttgaagaacagggtttttataatctgctagataacaaagaacaagcg
atcagcgcgattaaagatggtattgctattggtaagaatgtgattgtttgtggtggcaca
ggaagcggtaaaacgacttatatcaaaagcatcatggagtttatccctaaagaagaaagg
atcatatccattgaagacaccgaagagattgtattcaaacaccacaagaactacacacag
cttttttttggtgggaatatcacctctgctgattgtttaaagtcatgtttgagaatgcga
cctgatagaatcattttaggagaactcagaagcagtgaggcatatgatttttataatgtg
ctttgtagcggtcataaaggcacgctaaccactctacatgcagggagcagtgaagaagcg
tttatccgtttagccaacatgagttcatctaataacgcagcaaggaatatcaagtttgaa
agcctcattgagggctttaaagatttaattgatatgattgtccatatcaaccaccacaaa
cagtgtgatgaattttatatcaaacataggtag

DBGET integrated database retrieval system