KEGG   Helicobacter pylori F32: HPF32_0673Help
Entry
HPF32_0673        CDS       T01911                                 

Gene name
galU
Definition
UDP-glucose pyrophosphorylase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
heq  Helicobacter pylori F32
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:heq00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:heq00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:heq00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:heq00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(739006..739827)
Genome map
AA seq 273 aa AA seqDB search
MIKKCLFPAAGYGTRFLPITKTIPKEMLPIVDKPLIQYAVEEAMEAGCEVMAIVTGRNKR
SLEDYFDTSYEIEHQIQGTNKENALKSIRNIIEKCCFSYVRQKQMKGLGHAILTGEALIG
NEPFAVILADDLCISHDYPSVLKQMISLYQKYQCSIVAIEEVALEEVSKYGVIRGEWLEE
GVYEIKDMVEKPSQEDAPSNLAVIGRYILTPDIFEILSETKPGKNNEIQITDALRTQAKR
KRIIAYQFKGKRYDCGSVEGYIEASNAYYKKRL
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaaaatgcctttttcctgccgctggctacggcacacgctttttgccgatcact
aaaaccattcctaaagaaatgctgcccattgtggataagcctttaatccaatacgctgta
gaagaagcgatggaagcaggctgtgaagtgatggcgatcgttacaggcagaaacaaacga
agcttagaagattattttgacacgagctatgaaatagagcatcaaatccaaggcactaac
aaagaaaacgccctaaaaagcattcgtaacattatagagaaatgctgtttttcctatgtg
cgccaaaagcaaatgaaaggcttagggcatgcgattttaaccggagaagccctcataggc
aatgagccttttgcggtgattttagccgatgacttatgcataagccatgattatccaagc
gtgttaaaacaaatgatttcattgtatcaaaaataccaatgctctattgtagccattgaa
gaagtggcgctagaagaagtttcaaaatacggcgtgattaggggcgaatggttagaagag
ggggtgtatgagattaaagacatggtggaaaaaccaagccaagaagacgccccaagcaat
ctagccgtgatagggcgctacattttaactccggatatttttgaaattttaagcgagacg
aaaccgggtaaaaacaatgaaatccaaatcacggatgccttacgcactcaagccaaaaga
aaacggatcatcgcttaccaattcaaaggcaaacgatacgattgcgggagcgtggaaggc
tatattgaagcgagtaacgcttattataaaaaacgcttataa

DBGET integrated database retrieval system