KEGG   Helicobacter pylori F32: HPF32_0906Help
Entry
HPF32_0906        CDS       T01911                                 

Gene name
acoE
Definition
acetyl-CoA synthetase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
heq  Helicobacter pylori F32
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:heq01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:heq00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:heq00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:heq00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:heq00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
977248..979236
Genome map
AA seq 662 aa AA seqDB search
MQLDDDLEFAKKIFNPNRAFAKQARIKNMCEYKDLVHEANEDYEHFWGELAKQKLTWFKP
FDKVLNSDNAPFFKWFENGKINVSYNCIDRHLKDRKNKVAIIFEGEMGDYNVITYRKLHS
EVNKTANLLKNEFNVKKGDRIIIYMPMIVESVYMMLACARIGAIHSIVFAGFSPEALRDR
INDAQAKLVITADGTFRKGKPYMLKPALDKALENNACPSVEKALIVIRNAKEIDYVRGRD
FVYNEMVNYQSDKCEPEMMDSEDPLFLLYTSGSTGKPKGVQHSSAGYLLWAQMTMEWVFD
IRDNDNFWCTADIGWITGHTYVVYGPLACGATTLILEGTMSYPDYGRWWRMIEEYRVDKF
YTSPTAIRMLHAKGENEPLKYNLESLKVLGTVGEPINPTAWKWFYEKIGNSKCSIVDTWW
QTETGGHIISPLPGATPIRASCATLPLPGIHAEVLNEDGTKTKPGEQGFLCITKPWPSMV
RNIWGDEKRYIDNYFSQIKLNGEYVYLSGDGAIVDENGYITIIGRTDDIVNVSGHRIGTA
EVESAISKHEMVVECAVVGIPDMIKGEGLFAFVVLCDGAKCNLGESLELLKEMNHILSVE
IGKIAKLDNVMYVPGLPKTRSGKIMRRLLKSIAKKEPITQDLSTLEDVNVVKEIMSIVQM
EE
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
atgcaattagacgatgatttagaattcgctaaaaaaatctttaaccctaacagagcgttt
gccaagcaagccaggattaaaaacatgtgcgaatataaagatttagtgcatgaagccaat
gaagattatgaacatttttggggcgagttagccaagcaaaaactcacatggtttaagccc
tttgataaggttttaaacagcgataacgccccttttttcaaatggtttgaaaacggcaaa
atcaatgtttcttacaattgcatagacaggcatttaaaagacagaaaaaataaagtggcg
atcatttttgaaggggaaatgggggattataatgtcatcacttacagaaaactccactct
gaagtcaataaaacagccaaccttttaaaaaacgaattcaatgtcaaaaaaggcgataga
atcattatctatatgcccatgattgtagaaagcgtttatatgatgctcgcatgcgctagg
attggagcgatccatagcatcgtttttgctgggtttagccctgaagccttgagggataga
atcaacgacgctcaagccaaattagttatcacagcagatgggacttttagaaaaggcaaa
ccctatatgctcaagccagcccttgacaaggctctagaaaataacgcctgccctagtgtg
gaaaaagcgctcattgtgatacgaaacgccaaagagattgactatgtgagagggcgcgat
tttgtctataatgaaatggtcaattaccaatccgataaatgcgaacctgaaatgatggac
tctgaagatcctttatttttgctctatacaagcggatcaaccgggaaacctaaaggtgtt
caacatagcagtgcagggtatttgctatgggcacaaatgacgatggaatgggtttttgat
attagagataacgataatttttggtgcaccgctgatattggctggatcacagggcacact
tatgtggtttatgggcctttagcttgtggggcgacaactttgatactagaaggcacgatg
tcttatccggattatgggagatggtggaggatgatagaagaataccgcgtggataaattc
tacacttcccccaccgctataagaatgctgcatgctaaaggcgaaaacgaacccttaaag
tataatttagaatcgctcaaagttttaggaacggtaggagagcccattaaccctacggca
tggaaatggttttatgaaaaaatcggtaattcaaaatgcagtatcgtggatacttggtgg
cagacagaaacaggcgggcatatcatcagccctttaccgggagctacgcctataagggct
agttgtgcgaccttacctttgcctggaatccatgcagaagttttaaacgaagacggcacc
aaaacaaagcccggagagcaagggtttttatgcatcactaagccatggccttctatggta
agaaacatttggggcgatgaaaaacgatacattgacaactatttttctcagatcaagttg
aatggggaatatgtctacctctctggagatggcgctatcgtggatgaaaacggatacatc
actattattgggcgcacagatgatattgtgaatgtgagtgggcataggattggcacggct
gaagtggagagcgctatttctaaacatgaaatggtggttgaatgcgcggtagtgggtatc
cctgatatgattaaaggagagggcttgtttgcgtttgtggtgctgtgcgatggggctaaa
tgcaatcttggcgagagtttagaattgttaaaagaaatgaatcatatcttatccgttgag
attggaaagatcgctaaattagacaatgtcatgtatgtgccaggtttgcctaaaaccagg
agcgggaaaatcatgagaaggcttttgaaatctatcgccaaaaaagagcccatcactcaa
gatttaagcacgctagaagatgtgaatgtggtcaaagaaataatgagtatcgttcaaatg
gaagagtga

DBGET integrated database retrieval system