KEGG   Helicobacter pylori F32: HPF32_1028Help
Entry
HPF32_1028        CDS       T01911                                 

Gene name
pcm
Definition
protein-L-isoaspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
heq  Helicobacter pylori F32
Brite
Enzymes [BR:heq01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     HPF32_1028 (pcm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1095482..1096111
Genome map
AA seq 209 aa AA seqDB search
MNSIKNHLMCEEINKRFNLHPKVREAMESIEREIFVPAPFKHFAYTLNALSMQAQQYISS
PLTVAKMTQYLEIDHVDSVLEIGCGSGYQAAVLSQIFRRVFSIERIESLYIEARLRLKTL
GLNNVHVKFADGNKGWDQYAPYDRILFSACAKNIPQALIDQLEEGGILVAPIQENNEQVI
KRFVKQNNALRVQKVLEKCLFVPVVDGVQ
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
ttgaatagtattaaaaaccatttgatgtgtgaagaaatcaataagcgtttcaatttgcac
cccaaagtgagagaggctatggagagcattgaaagggaaatctttgtgccagcccccttt
aaacattttgcttacactttaaacgcgctttccatgcaagcgcaacaatacatttcttcg
cccctaaccgtggccaaaatgacgcaatatttagaaattgatcatgtggatagcgtgcta
gaaattggttgcgggagcggctatcaagcggcggtgctgtctcaaattttcaggcgcgtt
tttagcattgaaaggattgaaagcctgtatatagaagcgcgtttgcgccttaaaactctc
ggtttaaacaatgtccatgttaaattcgctgacgggaataagggctgggatcaatacgcc
ccctatgataggattttgttctctgcttgcgctaaaaatatccctcaagcgctcattgat
cagcttgaagaaggcgggatattagtcgcgcccattcaagaaaataacgagcaagtgatc
aaacgctttgtgaagcaaaataacgccttgcgcgtccaaaaagtgttagaaaaatgcttg
ttcgtgcctgttgtagatggggtgcaataa

DBGET integrated database retrieval system