KEGG   Helicobacter pylori F32: HPF32_1039Help
Entry
HPF32_1039        CDS       T01911                                 

Gene name
glk
Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
heq  Helicobacter pylori F32
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:heq00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HPF32_1039 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HPF32_1039 (glk)
   00052 Galactose metabolism
    HPF32_1039 (glk)
   00500 Starch and sucrose metabolism
    HPF32_1039 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    HPF32_1039 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    HPF32_1039 (glk)
   00524 Butirosin and neomycin biosynthesis
    HPF32_1039 (glk)
Enzymes [BR:heq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     HPF32_1039 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1107366..1108376
Genome map
AA seq 336 aa AA seqDB search
MPKTETYPRLLADIGGTNARFGLEVAPRQIECIEVLPCKDFESLSDAVRFYLSKCKESLK
LHPTYGSFAVATPIMGDFVQMTNNHWTFSIETTRQCLNLKKLLVINDFVAQAYAISAMQE
NDLAQIGGIKCEINAPKAILGPGTGLGVSTLIQNGDGSLKVLPGEGGHVSFAPFDDLEIL
VWQYARSKFNHVSAERFLSGSGLVLIYEALSKRKGLEKVAKLSKAELTPQIISERALNGD
YPICRLTLDTFCSMLGTLAADVALTLGARGGVYLCGGIIPRFIDYFKTSPFRARFETKGR
MGAFLASIPVHVVLKKTPGLNGAGIALENYLLHDKI
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaaactgaaacttacccaagactattagccgatattggcggcacgaacgcgcgc
tttggcttggaagtcgccccacgacagattgaatgcattgaagtcttgccatgcaaagat
tttgaaagcttgagcgatgcggtgcgattttatctttctaaatgcaaagaaagccttaaa
ctgcaccctacttatggctcttttgcggtggctacgcccattatgggggattttgtccaa
atgactaacaaccactggactttttctattgaaacgacacggcaatgtttgaatttaaaa
aaattgcttgtcatcaatgattttgtcgcgcaagcctatgccattagcgcgatgcaagaa
aacgatttggctcaaataggcgggattaaatgtgagatcaacgctcctaaagcgatttta
gggccaggaactgggcttggggtaagcactcttatccaaaatggcgatggctctttaaaa
gtcttgcccggtgaaggggggcatgtgagctttgccccttttgatgatttagaaatttta
gtgtggcaatacgcccgctctaaattcaatcatgtgagcgcggaaaggtttttgagcggg
agcggtttggtgttgatttatgaagccctgtctaaacgcaaaggcttagaaaaagtggcg
aagttaagcaaggctgaattaaccccacaaatcattagcgaacgcgctttgaatggggat
taccctatatgccgattgactttggacactttttgctccatgctaggcacgctcgctgct
gatgtggctctcactttgggggctagggggggcgtgtatttgtgtggggggattatccca
cgattcattgattattttaaaacttcgccctttagagcgcgttttgaaacgaaagggcgc
atgggagcgtttctcgcttctatccctgtgcatgtcgtgctgaaaaaaactccgggactt
aatggggcgggcattgcgttagagaattatttactgcatgataagatataa

DBGET integrated database retrieval system