KEGG   Helicobacter pylori F32: HPF32_1046Help
Entry
HPF32_1046        CDS       T01911                                 

Gene name
porD
Definition
(GenBank) pyruvate flavodoxin oxidoreductase subunit delta
  KO
K00171  pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
heq  Helicobacter pylori F32
Pathway
heq00010  Glycolysis / Gluconeogenesis
heq00020  Citrate cycle (TCA cycle)
heq00620  Pyruvate metabolism
heq00640  Propanoate metabolism
heq00650  Butanoate metabolism
heq00680  Methane metabolism
heq01100  Metabolic pathways
heq01120  Microbial metabolism in diverse environments
heq01130  Biosynthesis of antibiotics
heq01200  Carbon metabolism
Module
heq_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:heq00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HPF32_1046 (porD)
   00020 Citrate cycle (TCA cycle)
    HPF32_1046 (porD)
   00620 Pyruvate metabolism
    HPF32_1046 (porD)
   00640 Propanoate metabolism
    HPF32_1046 (porD)
   00650 Butanoate metabolism
    HPF32_1046 (porD)
  Energy metabolism
   00680 Methane metabolism
    HPF32_1046 (porD)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    HPF32_1046 (porD)
Enzymes [BR:heq01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     HPF32_1046 (porD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4 Fer4_21 Fer4_6 Fer4_10 Fer4_2 Fer4_7 Fer4_9 Fer4_17 Fer4_16 Fer4_15 Fer4_13 Fer4_8 Fer4_4 Fer4_22 Fer4_3
Motif
Other DBs
NCBI-ProteinID: BAJ58628
UniProt: E6NLB1
Position
1115121..1115513
Genome map
AA seq 130 aa AA seqDB search
MKDWNEFEMGAVLFPFEKNAQSEMEKHNDERHYTEQSYFTTSVAHWRVAKPVHNNNICIN
CFNCWVYCPDAAILSREGKLKGVDYSHCKGCGVCVDVCPTNPKSLWMFEEQIEPATALTQ
WPQKQEKKKS
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgaaagattggaatgaatttgaaatgggagcggtgctcttcccttttgaaaaaaacgca
caaagcgaaatggaaaaacacaatgatgagcgccattacaccgagcaaagctacttcacc
acttcagtggctcattggcgcgtggctaagcctgtgcataacaataacatttgcatcaat
tgctttaattgttgggtttattgcccagacgctgctattctttcaagagagggcaagtta
aaaggcgtggattattctcattgtaaaggctgtggcgtgtgcgtggatgtctgccccacc
aaccctaaatcgctatggatgtttgaagaacaaattgagcctgctaccgctctcactcaa
tggccgcaaaaacaagaaaagaaaaaatcataa

DBGET integrated database retrieval system