KEGG   Helicobacter pylori F32: HPF32_1205Help
Entry
HPF32_1205        CDS       T01911                                 

Gene name
algC
Definition
phosphomannomutase
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
heq  Helicobacter pylori F32
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:heq00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HPF32_1205 (algC)
   00030 Pentose phosphate pathway
    HPF32_1205 (algC)
   00051 Fructose and mannose metabolism
    HPF32_1205 (algC)
   00052 Galactose metabolism
    HPF32_1205 (algC)
   00500 Starch and sucrose metabolism
    HPF32_1205 (algC)
   00520 Amino sugar and nucleotide sugar metabolism
    HPF32_1205 (algC)
  Nucleotide metabolism
   00230 Purine metabolism
    HPF32_1205 (algC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    HPF32_1205 (algC)
Enzymes [BR:heq01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     HPF32_1205 (algC)
    5.4.2.8  phosphomannomutase
     HPF32_1205 (algC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1289381..1290757
Genome map
AA seq 458 aa AA seqDB search
MDISIFREYDIRGIYPTTLDEKSAFSIGVELGKIMRKYDKSVFVGHDARVHGRSLFEALS
AGLQSSGLKVYDLGLIPTPVAYFAAFNEIDNIQCPNSIMITGSHNPKEYNGFKITLNQNP
FYGKDIQALKDTLLNAKHEIKPLKEIPQKVNALEAYQRYLIKDFKHLKNLKYKIALDFGN
GVGALGLEPILKALNIDFSSLYSDPNGDFPNHHPDPSEAKNLQDLEKHMQENAILIGFAF
DGDADRIAMLSSHHIYAGDELAILFAKRLHAQGITPFVIGEVKCSQVMYNTINTFGKTLM
YKTGHSNLKIKLKETHAHFAAEMSGHIFFKERYFGYDDALYACLRALELLLEQTPSDLEN
TIKNLPYSYTTPEEKIAVSEEEKFEIIHNLQETLKNPPSHFPKIKEIISIDGVRVVFEHG
FGLIRASNTTPYLVSRFEGKDETTALEYKKALLNLLEK
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atggacatcagcatttttagagaatatgatattagaggcatttaccccaccactttagat
gaaaagagtgcctttagtatcggcgtggagttagggaaaatcatgcgaaaatacgataaa
agcgtttttgtagggcatgacgccagggtgcatgggcgatcgctttttgaagctttgagc
gcagggttacaatcaagcggcttgaaagtgtatgatttagggctaatccccacaccggta
gcgtattttgcggcctttaatgaaatagataacatccaatgccccaattctatcatgatc
actggttctcacaaccccaaagaatacaacggctttaaaatcacgctcaatcaaaacccg
ttttatggtaaggacattcaagctttaaaagacacgcttttaaacgcaaagcatgaaata
aaacccctaaaagaaataccacagaaagtcaatgccctagaagcgtatcagcgctatttg
atcaaggattttaaacatttaaaaaaccttaaatacaaaatcgccctggattttggtaat
ggcgtgggagcgttaggcttagagcctattttaaaggctttaaacattgattttagcagc
ctttatagcgatcctaatggggatttccctaaccaccacccagatcctagcgaagcgaaa
aacttacaagatttagaaaaacacatgcaagaaaacgctattttgataggctttgctttt
gatggcgatgcagacaggattgcgatgttaagctctcatcatatttatgcgggcgatgaa
ttagcgattttattcgctaaacgcttgcatgctcaaggcatcaccccctttgtgatcggc
gaagtcaaatgctctcaagtgatgtataacacgatcaatacttttggtaagacgctcatg
tataaaaccgggcatagcaatttaaagatcaaactcaaagaaacccatgcgcattttgcg
gctgaaatgagcgggcatatcttttttaaagaacgctattttggctatgatgacgctctt
tatgcatgcttaagggctttagaattattgcttgaacaaaccccaagcgatttggaaaac
accattaaaaacctcccctattcctacaccacgcctgaagaaaaaatcgccgtgagcgaa
gaagaaaaatttgaaatcattcataacctgcaagaaacgcttaaaaacccgccaagtcat
ttccctaaaatcaaagaaataatcagcattgatggcgtgagagtggtttttgaacatggt
tttgggcttattcgcgcaagcaacaccaccccgtatttagtcagccgctttgaaggcaag
gatgaaacaacagcgttagagtataaaaaagcgctactcaatttgctagagaaataa

DBGET integrated database retrieval system