KEGG   Helicobacter pylori F32: HPF32_1207Help
Entry
HPF32_1207        CDS       T01911                                 

Gene name
trpB
Definition
tryptophan synthase subunit beta
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
heq  Helicobacter pylori F32
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:heq01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:heq00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:heq00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1292260..1293435)
Genome map
AA seq 391 aa AA seqDB search
MNKKAYFGEFGGSFVSELLVSALRELEQAFDACLKDEKFQKEYFHLLKDFVGRPSPLTLC
QNIVSNPKVKLYLKREDLIHGGAHKTNQALGQALLAKKMGKKRIIAETGAGQHGVATAIA
CALLGLKCVIFMGAKDIKRQEMNVFRMRLLGAEVREVNSGSATLKDAVNEALRDWASSYK
DTHYLLGTAAGPHPYPTMVKTFQKMIGDEVKSQILEKENRLPDYVIACVGGGSNAIGVFS
AFLNDKEVKLIGVEPAGLGLETNKHGATLNKGRVGILHGNKTYLLQDDEGQITESHSISA
GLDYPGVGPEHSYLKESGRAIYESTSDLEALEAFSLLCQKEGIIPALESSHALAYALKLA
QKCEEESIMVVNLSGRGDKDLSTVYNALKGV
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaaaagcgtattttggggagtttggagggagttttgtttcggagttattagtg
tctgcattaagagagctagaacaggcgtttgatgcgtgtttgaaagatgaaaaattccaa
aaagaatattttcatcttttaaaagattttgtgggccgtcctagccccttaaccttgtgt
caaaatatcgtttctaaccctaaagttaagctttatctaaaacgagaagatttaatccat
ggcggggcgcataagactaatcaggctttagggcaagcccttttagcgaaaaaaatgggt
aaaaaaaggattattgctgaaacaggcgccggtcagcatggcgtggcgacggctatcgct
tgcgcgttgttgggtttaaaatgcgtgatttttatgggggctaaagacatcaaacgccaa
gaaatgaatgtttttagaatgcgcttattaggcgctgaagtcagagaggttaattcaggg
agcgcgacgcttaaagacgctgtgaatgaggccttaagggattgggcgagcagttacaag
gacacgcattatttgctaggcacagccgccgggccacacccttaccctacgatggttaaa
acctttcaaaagatgataggcgatgaggttaaaagccaaattttagaaaaagaaaaccgc
ttgcctgattatgttatcgcatgcgttggaggggggtctaacgctataggggtatttagc
gcgtttttaaacgacaaagaggttaaactcataggcgtagagccagcgggtttagggcta
gaaaccaataagcatggggcgactttgaataaggggcgtgtggggattttgcatgggaat
aaaacctatcttttacaagatgatgaaggccagattacagaaagccatagcattagcgcc
gggcttgattatccaggagtggggccagaacacagctatttaaaagagagcgggcgtgcg
atttatgaaagcacaagcgatcttgaagcgctagaagcctttagtttgttgtgccaaaaa
gaaggcattatcccggcgctagaaagctcacacgctttagcgtatgctttaaaactcgct
caaaaatgcgaagaagaaagcatcatggtagtgaatttaagcggtcgaggggataaggat
ttaagcaccgtttataacgctttaaaaggggtttaa

DBGET integrated database retrieval system