KEGG   Helicobacter pylori F32: HPF32_1207Help
Entry
HPF32_1207        CDS       T01911                                 

Gene name
trpB
Definition
(RefSeq) tryptophan synthase subunit beta
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
heq  Helicobacter pylori F32
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:heq00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HPF32_1207 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HPF32_1207 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HPF32_1207 (trpB)
Enzymes [BR:heq01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HPF32_1207 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1292260..1293435)
Genome map
AA seq 391 aa AA seqDB search
MNKKAYFGEFGGSFVSELLVSALRELEQAFDACLKDEKFQKEYFHLLKDFVGRPSPLTLC
QNIVSNPKVKLYLKREDLIHGGAHKTNQALGQALLAKKMGKKRIIAETGAGQHGVATAIA
CALLGLKCVIFMGAKDIKRQEMNVFRMRLLGAEVREVNSGSATLKDAVNEALRDWASSYK
DTHYLLGTAAGPHPYPTMVKTFQKMIGDEVKSQILEKENRLPDYVIACVGGGSNAIGVFS
AFLNDKEVKLIGVEPAGLGLETNKHGATLNKGRVGILHGNKTYLLQDDEGQITESHSISA
GLDYPGVGPEHSYLKESGRAIYESTSDLEALEAFSLLCQKEGIIPALESSHALAYALKLA
QKCEEESIMVVNLSGRGDKDLSTVYNALKGV
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaaaagcgtattttggggagtttggagggagttttgtttcggagttattagtg
tctgcattaagagagctagaacaggcgtttgatgcgtgtttgaaagatgaaaaattccaa
aaagaatattttcatcttttaaaagattttgtgggccgtcctagccccttaaccttgtgt
caaaatatcgtttctaaccctaaagttaagctttatctaaaacgagaagatttaatccat
ggcggggcgcataagactaatcaggctttagggcaagcccttttagcgaaaaaaatgggt
aaaaaaaggattattgctgaaacaggcgccggtcagcatggcgtggcgacggctatcgct
tgcgcgttgttgggtttaaaatgcgtgatttttatgggggctaaagacatcaaacgccaa
gaaatgaatgtttttagaatgcgcttattaggcgctgaagtcagagaggttaattcaggg
agcgcgacgcttaaagacgctgtgaatgaggccttaagggattgggcgagcagttacaag
gacacgcattatttgctaggcacagccgccgggccacacccttaccctacgatggttaaa
acctttcaaaagatgataggcgatgaggttaaaagccaaattttagaaaaagaaaaccgc
ttgcctgattatgttatcgcatgcgttggaggggggtctaacgctataggggtatttagc
gcgtttttaaacgacaaagaggttaaactcataggcgtagagccagcgggtttagggcta
gaaaccaataagcatggggcgactttgaataaggggcgtgtggggattttgcatgggaat
aaaacctatcttttacaagatgatgaaggccagattacagaaagccatagcattagcgcc
gggcttgattatccaggagtggggccagaacacagctatttaaaagagagcgggcgtgcg
atttatgaaagcacaagcgatcttgaagcgctagaagcctttagtttgttgtgccaaaaa
gaaggcattatcccggcgctagaaagctcacacgctttagcgtatgctttaaaactcgct
caaaaatgcgaagaagaaagcatcatggtagtgaatttaagcggtcgaggggataaggat
ttaagcaccgtttataacgctttaaaaggggtttaa

DBGET integrated database retrieval system