KEGG   Helicobacter pylori F32: HPF32_1208Help
Entry
HPF32_1208        CDS       T01911                                 

Gene name
trpC
Definition
(GenBank) bifunctional indole-3-glycerol phosphate synthase/phosphoribosylanthranilate isomerase
  KO
K13498  indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
heq  Helicobacter pylori F32
Pathway
heq00400  Phenylalanine, tyrosine and tryptophan biosynthesis
heq01100  Metabolic pathways
heq01110  Biosynthesis of secondary metabolites
heq01130  Biosynthesis of antibiotics
heq01230  Biosynthesis of amino acids
Module
heq_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:heq00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HPF32_1208 (trpC)
Enzymes [BR:heq01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     HPF32_1208 (trpC)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     HPF32_1208 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS PRAI QRPTase_C
Motif
Other DBs
NCBI-ProteinID: BAJ58790
UniProt: E6NLS3
Position
complement(1293437..1294795)
Genome map
AA seq 452 aa AA seqDB search
MPSVLENILKDKLLEVSMLKKNHALATNINPSDRDFKKALLEKKTSFILECKKASPSKGL
IRKDFDLLKIAKTYEKFASCISVLADSKYFLGSYENIKMVAQHSIKPILCKDFIIDAFQI
KLARMMGANAVLLMLSVLDDKNYLELFNLAKSLSMSVLTEVSNKQEIKRLLKLQYDIIGI
NNRDLHTLKTDIDHTLKLRPLLPKDALIISESGIYSHAQIKALAPYVNGFLVGSSLMKEK
DLKKACIKLILGENKVCGLTRIKDAKAVYKNHFIYGGLIFEKSSPRYIKPKEALKITKAV
KKLDFVGVFVKDKIKKIQKIAKKLDLKAVQLYGYSQQEIAQLKKSLPKTCAIWQVVSVMS
ANDLAPKVKEASLILYDTKGDKMGGNGVSFDWGILENVKTPFMLAGGLNLDNIQKALKVK
ALGLDFNSGLETSPGIKNKDKIKRLARILREY
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgcctagcgtgttagaaaacatccttaaagacaagctcctagaagtttctatgcttaaa
aaaaatcacgctttagcgacaaacataaacccaagcgatagggattttaaaaaggcgtta
ctagaaaaaaagaccagctttattttagaatgcaaaaaagcatcgccctctaaaggttta
atcagaaaagattttgatctgttgaaaatagccaaaacttatgaaaaattcgcctcttgc
atttcagttttagccgattctaaatattttttaggctcttatgaaaacattaagatggtt
gcgcaacattccattaagcccattttatgcaaagattttatcattgatgcctttcaaatc
aaactcgctagaatgatgggggctaatgcggtgcttttaatgttaagcgtattagatgat
aagaattatttagagcttttcaacctcgctaaatccttaagcatgagcgtgctgactgaa
gtttccaataagcaagaaatcaagcgcttgctcaagctccaatacgacattatcggcatc
aataatagggatttacacaccttaaaaaccgatattgaccacacgctcaaattgcgcccc
cttttacctaaagacgcgctcattatcagcgagtccggtatttattcgcacgcgcaaatc
aaagccctagccccttatgtgaatggctttttagtgggcagctctttaatgaaagaaaag
gatttgaaaaaagcgtgtattaagttgattttaggcgaaaataaagtgtgcgggcttaca
agaattaaagacgctaaagccgtttataaaaaccattttatttatggaggtttgattttt
gaaaaatcttcgccaagatacatcaagcctaaagaagccctaaaaatcacaaaagcggtt
aaaaaattggattttgtgggcgtgtttgtgaaagataagattaaaaaaattcaaaaaatc
gccaaaaagcttgatttaaaagcggtgcagctttatggctattcgcaacaagaaatcgct
caattaaaaaaatcgctccctaaaacttgcgcgatttggcaagtagtgagtgtgatgagc
gctaacgatttagcgcctaaagttaaagaagcttctctaatcttatacgacactaagggg
gataaaatgggaggcaatggcgtgagttttgattggggtattttagaaaatgtcaaaacg
cctttcatgttagctggtgggcttaatttggataatattcaaaaagccttgaaagttaaa
gcgttgggtttggatttcaattcaggtttagaaacaagccctgggattaaaaataaggat
aaaatcaagcgattagcccgaattttaagagagtattaa

DBGET integrated database retrieval system