KEGG   Helicobacter pylori F32: HPF32_1330Help
Entry
HPF32_1330        CDS       T01911                                 

Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
heq  Helicobacter pylori F32
Pathway
heq00900  Terpenoid backbone biosynthesis
heq01100  Metabolic pathways
heq01110  Biosynthesis of secondary metabolites
heq01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:heq00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HPF32_1330
Enzymes [BR:heq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     HPF32_1330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N
Motif
Other DBs
NCBI-ProteinID: BAJ58912
UniProt: E6NM45
Position
1404389..1405192
Genome map
AA seq 267 aa AA seqDB search
MHAFEVYPKVNIFLKILHKAGAYHKLISRMCLVKDKLKDIISVKSALSFSLKGDFDCPLE
ENSLFKALQILKNFLKSKNFSHSVIKSLDTLAIEVEKNIPTQAGLGGGSADAGGLLYHLN
HIFDWRLSLEELYRMGSLVGADTNFFISQHKSANATSYGEVIENFEEEPLENRLEIYAPN
HVFCSTKAIYQAYKPKTCFSQAKEWLKKPSLECLKTYDRNELNDLLKPALLTNQALRGIE
SELGKEWFFSGSGSAFFRLKPALKGDE
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgcatgcttttgaggtttatcctaaagtcaatatttttttaaaaatccttcacaaagca
ggggcttaccataagctcatttctcgcatgtgtttagtcaaagacaagctaaaggatatt
atcagcgtcaaaagcgcgctttccttttcgctaaaaggggattttgactgccctttagaa
gaaaactcgctctttaaagccctccaaattttaaaaaattttttaaaatcaaaaaatttc
tctcattctgtcatcaaatccctagacaccctagcgattgaagtggaaaaaaacatcccc
actcaagccgggttgggcggtgggagcgctgatgctggggggctattgtatcatctaaat
cacatttttgactggcgtttgagtttagaagagctttatcgcatgggatctttagtgggt
gcagacaccaactttttcatctcgcaacacaaaagcgctaacgctacttcttatggcgaa
gtgattgaaaattttgaagaagagcctttagaaaatcgcctagaaatctatgcgccaaac
catgttttttgcagcaccaaagccatttatcaagcctataaacctaaaacttgtttttct
caagctaaagagtggcttaaaaagccgagtttagaatgcctaaagacttatgatagaaac
gaattaaacgatcttttaaaaccagccttactcactaaccaagccttaagaggtatagaa
agcgaattaggcaaggagtggttttttagcgggagtgggagcgcgttttttaggctaaag
cctgcgttaaaaggggacgaatga

DBGET integrated database retrieval system