KEGG   Helicobacter pylori Rif1: C695_01065Help
Entry
C695_01065        CDS       T02317                                 

Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
her  Helicobacter pylori Rif1
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:her01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:her00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(219100..220251)
Genome map
AA seq 383 aa AA seqDB search
MDALEITQKLISYPTITPKECGIFEYIKSLFPHFKTLECGENGVKNLFLYRIFNPPKDHA
EEKHAKENTKPLHFCFAGHIDVVPPGNHWQSDPFKPVIKEGFLYGRGAQDMKGGVGAFLS
ASLNFNPKTPFLLSILLTSDEEGPGIFGTRLMLEKLKEKDLLPHMAIVAEPTCEKVLGDS
IKIGRRGSINGKLILKGVQGHVAYPQKCQNPIDTLASVLPLISGVNLDNGDEYFDPSKLV
ITNLHAGLGANNITPASVEIIFNARHSLKTTKESLKEYLEKVLKDLPYTLELESSSSPFI
TASHSKLTSVLKENILKTCHTTPLLNTKGGTSDARFFSAHGIEVVEFGVINDRIHAIDER
VSLKELELLEKVFLGVLEGLSEA
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atggacgctttagaaatcacccaaaagctcatcagctaccccaccattacgcccaaagaa
tgcggtatttttgaatacattaaatcgctttttcctcattttaaaactctagagtgtgga
gaaaatggcgtgaaaaacctttttttataccgcatttttaacccccccaaagaccatgca
gaagaaaagcatgcaaaagagaataccaagcccttgcatttttgctttgcagggcatatt
gatgtcgtgcctcctggaaatcattggcaaagcgatccttttaaacccgttattaaagag
gggtttttatacggccgtggggcgcaagacatgaaaggaggcgtgggggcgtttttgagc
gcgagtttaaattttaaccctaaaaccccttttttgctttctattttactcacaagcgat
gaagaagggccagggatttttggcactaggcttatgttagaaaaactcaaagaaaaagat
ttgctgcctcatatggcgattgtggctgaacccacttgcgaaaaagtcttaggcgatagc
atcaaaattggccgaagaggctccattaatggcaaactcattttaaaaggcgttcaaggg
catgtggcttacccgcaaaaatgccaaaaccctattgatacgctcgcttcggttttgcct
ctcatttcaggagttaatttagacaatggcgatgaatattttgacccttcaaaattagtc
atcaccaacttgcatgcagggttaggagcgaataatattaccccagcaagcgtagaaatc
atctttaatgcacgccattctttaaaaaccaccaaagagagtttgaaagaatatttagaa
aaagttttgaaagatttgccttatactttagaattagaatcaagcagttcgcctttcatc
acggcttctcattcaaagcttaccagcgttttaaaagaaaatattttaaaaacatgccac
accaccccccttttaaacaccaaaggcggcacgagcgatgcgcgattttttagcgctcat
ggtatagaagtggtggagtttggcgttattaatgacaggatccatgccattgatgaaagg
gtgagcttgaaagaattagagcttttagaaaaagtgtttttgggggttttagagggcttg
agtgaggcataa

DBGET integrated database retrieval system