KEGG   Helicobacter pylori Rif1: C695_01065Help
Entry
C695_01065        CDS       T02317                                 

Definition
(GenBank) succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
her  Helicobacter pylori Rif1
Pathway
her00300  Lysine biosynthesis
her01100  Metabolic pathways
her01120  Microbial metabolism in diverse environments
her01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:her00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    C695_01065
Enzymes [BR:her01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     C695_01065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer
Motif
Other DBs
NCBI-ProteinID: AFV43028
Position
complement(219100..220251)
Genome map
AA seq 383 aa AA seqDB search
MDALEITQKLISYPTITPKECGIFEYIKSLFPHFKTLECGENGVKNLFLYRIFNPPKDHA
EEKHAKENTKPLHFCFAGHIDVVPPGNHWQSDPFKPVIKEGFLYGRGAQDMKGGVGAFLS
ASLNFNPKTPFLLSILLTSDEEGPGIFGTRLMLEKLKEKDLLPHMAIVAEPTCEKVLGDS
IKIGRRGSINGKLILKGVQGHVAYPQKCQNPIDTLASVLPLISGVNLDNGDEYFDPSKLV
ITNLHAGLGANNITPASVEIIFNARHSLKTTKESLKEYLEKVLKDLPYTLELESSSSPFI
TASHSKLTSVLKENILKTCHTTPLLNTKGGTSDARFFSAHGIEVVEFGVINDRIHAIDER
VSLKELELLEKVFLGVLEGLSEA
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atggacgctttagaaatcacccaaaagctcatcagctaccccaccattacgcccaaagaa
tgcggtatttttgaatacattaaatcgctttttcctcattttaaaactctagagtgtgga
gaaaatggcgtgaaaaacctttttttataccgcatttttaacccccccaaagaccatgca
gaagaaaagcatgcaaaagagaataccaagcccttgcatttttgctttgcagggcatatt
gatgtcgtgcctcctggaaatcattggcaaagcgatccttttaaacccgttattaaagag
gggtttttatacggccgtggggcgcaagacatgaaaggaggcgtgggggcgtttttgagc
gcgagtttaaattttaaccctaaaaccccttttttgctttctattttactcacaagcgat
gaagaagggccagggatttttggcactaggcttatgttagaaaaactcaaagaaaaagat
ttgctgcctcatatggcgattgtggctgaacccacttgcgaaaaagtcttaggcgatagc
atcaaaattggccgaagaggctccattaatggcaaactcattttaaaaggcgttcaaggg
catgtggcttacccgcaaaaatgccaaaaccctattgatacgctcgcttcggttttgcct
ctcatttcaggagttaatttagacaatggcgatgaatattttgacccttcaaaattagtc
atcaccaacttgcatgcagggttaggagcgaataatattaccccagcaagcgtagaaatc
atctttaatgcacgccattctttaaaaaccaccaaagagagtttgaaagaatatttagaa
aaagttttgaaagatttgccttatactttagaattagaatcaagcagttcgcctttcatc
acggcttctcattcaaagcttaccagcgttttaaaagaaaatattttaaaaacatgccac
accaccccccttttaaacaccaaaggcggcacgagcgatgcgcgattttttagcgctcat
ggtatagaagtggtggagtttggcgttattaatgacaggatccatgccattgatgaaagg
gtgagcttgaaagaattagagcttttagaaaaagtgtttttgggggttttagagggcttg
agtgaggcataa

DBGET integrated database retrieval system