KEGG   Helicobacter pylori Rif1: C695_01165Help
Entry
C695_01165        CDS       T02317                                 

Definition
hypothetical protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
her  Helicobacter pylori Rif1
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
241195..241992
Genome map
AA seq 265 aa AA seqDB search
MILRASVLSALLLVGLGAAPKHSVSANDKRMQDNLVSVIEKQTNKKVRILEIKPLKSSQD
LKMVVIEDPDTKYNIPLVVSKDGNLIIGLSNIFFSNKSDDVQLVAETNQKVQALNATQQN
SAKLNAIFNEIPADYAIELPSTNAANKDKILYIVSDPMCPHCQKELTKLRDHLKENTVRM
VVVGWLGVNSAKKAALIQEEMAKARARGASVEDKISILEKIYSTQYDINAQKEPEDLRTK
VENTTKKIFESGVIKGVPFLYHYKA
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgatattaagagcgagtgtgttgagcgcgttacttcttgtaggcttaggggcagcccct
aaacattcagtttcagctaatgacaaacggatgcaggataatttagtgagcgtgattgaa
aaacagaccaataaaaaggtgcgtattttagaaatcaaacctttaaaatctagccaggat
ttaaaaatggtcgttattgaagatccggacactaaatacaatatcccgcttgtggtgagt
aaggatggtaatttaatcatagggcttagcaacatattctttagcaataaaagcgatgat
gtgcaattagttgcagaaaccaatcaaaaagttcaagctcttaacgccacccaacaaaat
agcgcgaaattgaacgctatttttaatgaaataccggctgattatgcgatagagttgccc
tctactaacgctgcaaataaggataaaatcctttatattgtctctgatcccatgtgccca
cattgccaaaaagagctcactaaacttagggatcatttaaaagaaaacaccgtgagaatg
gtcgtggtggggtggcttggggtcaattcagctaaaaaagcggctttaatccaagaagaa
atggcgaaagctagggctaggggagcgagcgtggaagataagatctctattcttgaaaag
atttattccacccaatacgatattaacgctcaaaaagagcctgaagatttacgcactaaa
gtggaaaataccactaaaaagatttttgaatctggcgtgattaagggtgtgcctttctta
taccattataaggcatga

DBGET integrated database retrieval system