KEGG   Helicobacter pylori Rif1: C695_04535Help
Entry
C695_04535        CDS       T02317                                 

Gene name
ruvA
Definition
holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
her  Helicobacter pylori Rif1
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:her03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(932831..933382)
Genome map
AA seq 183 aa AA seqDB search
MIVGLIGVVEKISALEVHIEVQGVVYGVQVSMRTAALLEAGQKARLKILQVIKEDAHLLY
GFLEEGEKILFERLLKINGVGGRIALAILSSFSPNEFESIIATKEVKRLQQVPGIGKKLA
DKIMVDLIGFFIQDENRPARNEVFLALESLGFKSAEINQVLKTLKPNLSIEAAIKEALQQ
LRS
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgatagtgggtttgataggggttgtggaaaaaatctccgctttagaagtgcatatagaa
gtgcaaggggttgtttatggggtgcaagtttctatgcgaacggctgctttgcttgaagcg
ggccaaaaagcgcgtttgaaaatcttgcaagtgatcaaagaagatgcacatcttttatac
gggtttttagaagagggcgaaaaaatcctttttgaaaggcttttaaaaatcaatggggta
ggggggcgtatcgctttagccattctttcaagcttttcgccgaacgaatttgaaagcatt
atcgccaccaaagaagtcaaaagactccagcaagtcccaggtatagggaaaaagctcgct
gataagatcatggtggatttgattggctttttcattcaagatgaaaacagacccgcacgc
aatgaggtttttttagccctagagagtttgggctttaaaagcgctgaaatcaaccaagtc
ttaaaaaccctaaaacccaatctcagcatagaagcagcgattaaagaagccctacaacaa
ctgcgctcttaa

DBGET integrated database retrieval system