KEGG   Helicobacter pylori Rif1: C695_04780Help
Entry
C695_04780        CDS       T02317                                 

Gene name
folE
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
her  Helicobacter pylori Rif1
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:her00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
991259..991801
Genome map
AA seq 180 aa AA seqDB search
MENFFNQFFESIGEDKNREGLKETPKRVQELWKFLYKGYKEDPRVALKSAYFQGVCDEMI
VAQNIEFYSTCEHHLLPFLGNISVGYIPKEKIVGISAIAKLIEIYSRRLQIQERLTIQIA
ETFDEIIEPRGVIVVCEAKHLCMSMQGVQKQNAIIKTSVLRGLFKKDSKTRAEFMQLLKS
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atggaaaattttttcaaccagttttttgaaagtatcggcgaagataagaatcgagaaggc
ttgaaagaaacgcctaaaagggttcaagaattatggaaattcttgtataaaggctataaa
gaagatcctagagtggctttaaaaagcgcgtattttcaaggcgtttgcgatgaaatgata
gtggctcaaaacattgaattttactccacttgcgagcaccatttgctcccttttttgggg
aatattagcgtgggatatatccctaaggaaaagattgtaggcattagcgcgatcgctaaa
ctcattgaaatttatagcagacgcctacaaatccaagaaaggctgaccattcaaattgca
gaaacctttgatgaaatcatagagccaaggggcgtgatcgtggtttgtgaagccaagcat
ttgtgcatgagcatgcaaggggtgcaaaagcaaaatgcgatcattaaaacaagcgttcta
agaggcctctttaaaaaagactctaaaaccagagctgaatttatgcaactcttaaaatct
tag

DBGET integrated database retrieval system