KEGG   Helicobacter pylori Rif1: C695_05695Help
Entry
C695_05695        CDS       T02317                                 

Gene name
glk
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
her  Helicobacter pylori Rif1
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:her00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    C695_05695 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    C695_05695 (glk)
   00052 Galactose metabolism
    C695_05695 (glk)
   00500 Starch and sucrose metabolism
    C695_05695 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    C695_05695 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    C695_05695 (glk)
   00524 Butirosin and neomycin biosynthesis
    C695_05695 (glk)
Enzymes [BR:her01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     C695_05695 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1164170..1165180
Genome map
AA seq 336 aa AA seqDB search
MPKTETYPRLLADIGGTNARFGLEVAPRQIECIEVLRCEDFESLSDAVRFYLSKCKESLK
LHPIYGSFAVATPIMGDFVQMTNNHWTFSIETTRQCLTLKKLLVINDFVAQAYAISAMQE
NDLAQIGGIKCEINAPKAILGPGTGLGVSTLIQNSDGSLKVLPGEGGHVSFAPFDDLEIL
VWQYARSKFNHVSAERFLSGSGLVLIYEALSKRKGLEKVAKLSKAELTPQIISECALNGD
YPICRLTLDTFCSMLGTLAADVALTLGARGGVYLCGGIIPRFIDYFKTSPFRARFETKGR
MGAFLASIPVHVVLKKTPGLDGAGIALENYLLHDKI
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaaactgaaacttacccaagactcttagccgatattggcggcacgaacgcgcgc
tttggcttggaagtcgccccacgacagattgaatgcattgaagtcttgaggtgcgaagat
tttgagagcttgagcgatgcggtacgattttacctttctaaatgcaaagaaagccttaaa
ctgcaccctatttatggctcttttgctgtggctacgcccattatgggggattttgtccaa
atgactaacaaccactggactttttctattgaaacgacgcggcaatgtttgactttaaaa
aaattgcttgtcatcaatgattttgtcgcgcaagcctatgccattagcgcgatgcaagaa
aacgatctggctcaaataggcgggattaagtgcgaaatcaacgctcctaaggcgatttta
gggccaggaacggggcttggggtaagcactcttatccaaaacagcgatggctctttaaaa
gtcttgcccggtgaaggagggcatgtgagctttgccccttttgatgatttagaaatttta
gtgtggcaatacgcccgttctaaattcaaccatgtgagcgcggaaaggtttttgagtggg
agcggtttggtgctgatttatgaagccctgtctaaacgcaaaggtttagaaaaagtggcg
aagttaagcaaggctgaattaaccccacaaattattagcgaatgcgctttgaatggggat
taccctatatgccgattgaccttggacactttttgctccatgcttggcacgctcgctgct
gatgtggctctcactttgggggctagggggggcgtgtatttgtgtggggggattatccca
cgattcattgattattttaaaacttcgccctttagagcacgttttgaaacgaaagggcgc
atgggagcgtttctcgcttctatccctgtgcatgtcgtgctgaaaaaaactcccggactt
gatggggcgggcattgcgttagagaattacttactgcatgataagatatag

DBGET integrated database retrieval system