KEGG   Helicobacter pylori Rif1: C695_06330Help
Entry
C695_06330        CDS       T02317                                 

Gene name
hemD
Definition
uroporphyrinogen-III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
her  Helicobacter pylori Rif1
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:her00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    C695_06330 (hemD)
Enzymes [BR:her01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     C695_06330 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
1300391..1301071
Genome map
AA seq 226 aa AA seqDB search
MREIVWVHSQRIAPYKTLILNEFCYYPLELDPTPFNALIFTSKNAVFSLLETLKNSPKLK
MLQNIPAYALSEPTAKTLQDHHFKVAFMGEKAHGKEFVQEIFPLLEKKSVLYLRAKEIVS
SLDTILLEHGIDFKQAVVYENKLKHLTLSEQNALKPKEKSILIFTAISHAKAFLHYFEFL
ENYTAISIGNTTALYLQEQGIPSYIAKKPSLEACLELALSLRIKEC
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgagggagattgtatgggtgcattctcaaagaatcgccccttataagactctcatctta
aatgaattttgctactatcccttagaattagatccaaccccttttaacgccttgattttc
acctctaaaaatgcggtattttccttgctagaaactctaaaaaacagccccaaactcaaa
atgttacaaaacattcctgcttacgctttgagcgaacccaccgcaaaaaccttacaagat
caccattttaaagtcgcctttatgggggaaaaagcccatggcaaagagtttgttcaagaa
atctttcctttattggaaaaaaaaagcgttttgtatctcagggcgaaagagattgtctct
tctttagacaccattcttttagagcatggcattgatttcaagcaagccgttgtctatgaa
aacaagctcaaacatttaaccttaagcgaacaaaacgccctaaaacccaaagaaaagagt
attcttatttttaccgctataagccacgcaaaagcctttttgcactattttgaattttta
gaaaattacaccgctataagcattggcaacacgaccgctctttatttacaagaacaaggc
attccaagctatattgccaaaaagccctccttggaagcgtgtttagaactggctttgagt
ttgagaattaaggaatgttaa

DBGET integrated database retrieval system