KEGG   Helicobacter pylori Rif1: C695_06600Help
Entry
C695_06600        CDS       T02317                                 

Definition
(GenBank) phosphomannomutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
her  Helicobacter pylori Rif1
Pathway
her00010  Glycolysis / Gluconeogenesis
her00030  Pentose phosphate pathway
her00051  Fructose and mannose metabolism
her00052  Galactose metabolism
her00230  Purine metabolism
her00500  Starch and sucrose metabolism
her00520  Amino sugar and nucleotide sugar metabolism
her00521  Streptomycin biosynthesis
her01100  Metabolic pathways
her01110  Biosynthesis of secondary metabolites
her01120  Microbial metabolism in diverse environments
her01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:her00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    C695_06600
   00030 Pentose phosphate pathway
    C695_06600
   00051 Fructose and mannose metabolism
    C695_06600
   00052 Galactose metabolism
    C695_06600
   00500 Starch and sucrose metabolism
    C695_06600
   00520 Amino sugar and nucleotide sugar metabolism
    C695_06600
  Nucleotide metabolism
   00230 Purine metabolism
    C695_06600
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    C695_06600
Enzymes [BR:her01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     C695_06600
    5.4.2.8  phosphomannomutase
     C695_06600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV
Motif
Other DBs
NCBI-ProteinID: AFV44088
Position
1350221..1351600
Genome map
AA seq 459 aa AA seqDB search
MDISIFREYDIRGIYPTTLDEKGAFSIGVELGKIMRECDKSVFVGHDARVHGRFLFEALS
AGLQSSGLKVYDLGLIPTPVAYFAAFNEINGIQCPNSIMITGSHNPKEYNGFKITLNQNP
FYGKDIQALKDTLLNAKHEIKPLKEIPEKANALEAYQRYLIKDFKHLKNLKYKIALDFGN
GVGALGLEPILKALNIDFNSLYSDPDGNFPNHHPDPSEAKNLKDLEKHMQENAISIGFAF
DGDADRIAMLSSHHVYAGDELAILFAKRLHAQGITPFVIGEVKCSQVMYNTINTFGKTLM
YKTGHSNLKIKLKETHAHFAAEMSGHIFFKERYFGYDDALYACLRALELLLEQTPSDLEN
TIKNLPYSYTTPEEKIAVSEEEKFEIIHNLQETLKNPPSHFPKIKEIISIDGVRVVFEHG
FGLIRASNTTPYLVSRFEGKDETTALEYKRALLNLLEKL
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atggacattagcatttttagagaatacgatattagaggcatttaccccaccactttagat
gagaagggggcttttagtatcggtgtggagttggggaaaatcatgcgagaatgcgataaa
agcgtgtttgtagggcatgacgcaagggtgcatgggcgctttttgtttgaagctttgagc
gcgggactgcaatcaagcggcttgaaagtgtatgatttagggctaatccccacaccggta
gcgtattttgcagcctttaatgaaatcaatggcattcaatgccctaattccatcatgatc
actggctctcacaaccccaaagaatacaacggctttaaaatcacgctcaaccaaaacccg
ttttatggcaaggacattcaggctttaaaagacacgcttttaaacgcaaagcatgaaata
aaacccctaaaagaaataccagagaaagccaatgccctagaagcgtatcagcgctatttg
atcaaggattttaaacatttaaaaaaccttaaatacaaaatcgccctggattttggtaat
ggcgtgggagcgttaggcttagagcctattttaaaggctttaaacattgattttaatagc
ctttatagcgatcctgatgggaatttccctaaccaccacccagaccctagcgaagcgaaa
aacttaaaagatttagaaaaacacatgcaagaaaacgctatttctataggctttgctttt
gatggcgatgcggataggattgcgatgttaagctctcatcatgtttatgcgggcgatgaa
ttagcgattttattcgctaaacgcttgcatgctcaaggcatcaccccctttgtgatcggc
gaagtcaaatgctctcaagtgatgtataacacgatcaatacttttggtaagacgctcatg
tataaaaccgggcatagcaatttaaaaatcaaactcaaagaaacccatgcgcattttgcg
gctgaaatgagcgggcatatcttttttaaagagcgctattttggctatgatgacgctctt
tatgcatgcttaagggctttagaattattgcttgaacaaaccccaagcgatttggaaaac
accattaaaaacctcccctattcctacaccacgcctgaagaaaaaatcgccgtgagcgaa
gaagaaaaatttgaaatcattcataacctacaagaaacgcttaaaaacccgccaagccat
ttccctaaaatcaaagaaatcatcagtattgatggcgtgagggtggtttttgaacatggt
tttgggcttattcgtgcaagcaacaccaccccctatttagtcagccgctttgaaggcaag
gatgaaacaacggcgttagagtataaaagggcgttgctcaatttattagaaaaactttaa

DBGET integrated database retrieval system