KEGG   Helicobacter pylori SouthAfrica7: HPSA_00510Help
Entry
HPSA_00510        CDS       T01921                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
hes  Helicobacter pylori SouthAfrica7
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:hes00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HPSA_00510
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HPSA_00510
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    HPSA_00510
Enzymes [BR:hes01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     HPSA_00510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(100600..102054)
Genome map
AA seq 484 aa AA seqDB search
MPFVPTRSLKERKIDFIEAILNPNAPKGGLYTLERFETLEWQDCLNLSYNELVECVFERL
GLEVSKGLLADALKRYENFDNPKNPAPIFALNERLFVQELYHGPSLAFKDMALQPLASLF
SNLAVGKNEKYLMLVSTSGDTGPATLEGLANMPNVFVVCLYPKDGTSLVQKLQMVTQNAS
NLKVFGISGDFDDAQNALKNLLKDDDFNEALKTHQLKLSVANSVNFGRIAFQVVYHIWGF
LELYKKGAINSKEKITLAIPSGNFGNALGAFYAKKMGLNIAKIKVVTNSNDVLREFIETG
RYDLTKRSLKQTFSPAMDILKSSNVERVLFDLFGFERTLELMQALEEEKFYELKPKELAL
LQEHFSCASCSDEDCLKTIQEVYAEHQYLIDPHTATALNASLKTNEKTLVSSTASYEKFP
STTLLALNEQKKDDKTALEALKNNYNTPDSKRLDDLFEREIKYQEVLKLNEIKSSILLWL
ESIH
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgccttttgtccccacgcgctctttgaaagaaagaaagattgattttattgaagcgata
ctaaaccctaacgcccctaaaggcgggctttacactttagagcgttttgaaacattagaa
tggcaagattgtttgaatctgagctataacgagctagtagaatgcgtgtttgaacgattg
ggcttagaagtttctaaaggtttattggcagacgctttaaaacgctatgaaaattttgat
aaccctaaaaatccagcccctatttttgcactcaatgaaaggctttttgtccaagagctc
taccatgggcctagcctggcgtttaaagacatggcattgcagcctttagcgagcttgttt
tctaacctagcggtaggaaaaaatgaaaagtatttgatgctcgtttctacaagcggggat
accggccctgcgactttggaaggtttagcgaacatgcccaatgtttttgtggtgtgttta
taccccaaagacggcacaagtttagtccaaaaactccaaatggttacccaaaacgctagc
aatttaaaagtgtttgggatcagcggggattttgatgatgcgcaaaacgcgctcaaaaac
cttttaaaagacgatgattttaacgaagccctaaagacgcaccaattaaaattgagcgtg
gctaattccgtgaattttgggcgcatcgcttttcaagttgtctatcacatttggggcttt
ttagaattgtataaaaaaggcgcgatcaattctaaagaaaaaatcaccctagccataccg
agcggtaattttgggaatgcattaggggcgttttatgctaaaaaaatgggcttaaatatc
gctaaaatcaaggtggtaaccaatagcaatgatgttttaagggagtttatagaaacaggc
cgttacgatttgaccaagcgctcattgaaacaaactttctctccggctatggatatttta
aaaagctccaatgtggaaagggtgctttttgatctttttgggtttgaacgcacgctggaa
ttgatgcaagctttagaagaagagaaattttatgaactaaaacctaaagaattagccctt
ttacaggagcatttttcttgcgcgagctgctcagatgaagattgtttgaaaaccattcaa
gaagtttatgcagagcaccaatacctgattgacccccacaccgccaccgccttaaacgca
agcttaaaaaccaacgaaaaaacccttgtttcttccaccgcttcttatgaaaaattccct
agcaccacccttttagccctaaacgagcaaaaaaaagacgataaaaccgccctagaagcg
ctaaaaaacaattacaacactccggatagcaagcgccttgatgatttgtttgaaagagag
atcaaataccaagaagttttaaagctcaatgagatcaaatcctctatccttttgtggtta
gaaagcattcattaa

DBGET integrated database retrieval system