KEGG   Helicobacter pylori SouthAfrica7: HPSA_00510Help
Entry
HPSA_00510        CDS       T01921                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
hes  Helicobacter pylori SouthAfrica7
Pathway
hes00260  Glycine, serine and threonine metabolism
hes00750  Vitamin B6 metabolism
hes01100  Metabolic pathways
hes01110  Biosynthesis of secondary metabolites
hes01120  Microbial metabolism in diverse environments
hes01230  Biosynthesis of amino acids
Module
hes_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:hes00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HPSA_00510
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    HPSA_00510
Enzymes [BR:hes01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     HPSA_00510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_synth_N
Motif
Other DBs
NCBI-ProteinID: ADU84126
UniProt: E8QTU9
Position
complement(100600..102054)
Genome map
AA seq 484 aa AA seqDB search
MPFVPTRSLKERKIDFIEAILNPNAPKGGLYTLERFETLEWQDCLNLSYNELVECVFERL
GLEVSKGLLADALKRYENFDNPKNPAPIFALNERLFVQELYHGPSLAFKDMALQPLASLF
SNLAVGKNEKYLMLVSTSGDTGPATLEGLANMPNVFVVCLYPKDGTSLVQKLQMVTQNAS
NLKVFGISGDFDDAQNALKNLLKDDDFNEALKTHQLKLSVANSVNFGRIAFQVVYHIWGF
LELYKKGAINSKEKITLAIPSGNFGNALGAFYAKKMGLNIAKIKVVTNSNDVLREFIETG
RYDLTKRSLKQTFSPAMDILKSSNVERVLFDLFGFERTLELMQALEEEKFYELKPKELAL
LQEHFSCASCSDEDCLKTIQEVYAEHQYLIDPHTATALNASLKTNEKTLVSSTASYEKFP
STTLLALNEQKKDDKTALEALKNNYNTPDSKRLDDLFEREIKYQEVLKLNEIKSSILLWL
ESIH
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgccttttgtccccacgcgctctttgaaagaaagaaagattgattttattgaagcgata
ctaaaccctaacgcccctaaaggcgggctttacactttagagcgttttgaaacattagaa
tggcaagattgtttgaatctgagctataacgagctagtagaatgcgtgtttgaacgattg
ggcttagaagtttctaaaggtttattggcagacgctttaaaacgctatgaaaattttgat
aaccctaaaaatccagcccctatttttgcactcaatgaaaggctttttgtccaagagctc
taccatgggcctagcctggcgtttaaagacatggcattgcagcctttagcgagcttgttt
tctaacctagcggtaggaaaaaatgaaaagtatttgatgctcgtttctacaagcggggat
accggccctgcgactttggaaggtttagcgaacatgcccaatgtttttgtggtgtgttta
taccccaaagacggcacaagtttagtccaaaaactccaaatggttacccaaaacgctagc
aatttaaaagtgtttgggatcagcggggattttgatgatgcgcaaaacgcgctcaaaaac
cttttaaaagacgatgattttaacgaagccctaaagacgcaccaattaaaattgagcgtg
gctaattccgtgaattttgggcgcatcgcttttcaagttgtctatcacatttggggcttt
ttagaattgtataaaaaaggcgcgatcaattctaaagaaaaaatcaccctagccataccg
agcggtaattttgggaatgcattaggggcgttttatgctaaaaaaatgggcttaaatatc
gctaaaatcaaggtggtaaccaatagcaatgatgttttaagggagtttatagaaacaggc
cgttacgatttgaccaagcgctcattgaaacaaactttctctccggctatggatatttta
aaaagctccaatgtggaaagggtgctttttgatctttttgggtttgaacgcacgctggaa
ttgatgcaagctttagaagaagagaaattttatgaactaaaacctaaagaattagccctt
ttacaggagcatttttcttgcgcgagctgctcagatgaagattgtttgaaaaccattcaa
gaagtttatgcagagcaccaatacctgattgacccccacaccgccaccgccttaaacgca
agcttaaaaaccaacgaaaaaacccttgtttcttccaccgcttcttatgaaaaattccct
agcaccacccttttagccctaaacgagcaaaaaaaagacgataaaaccgccctagaagcg
ctaaaaaacaattacaacactccggatagcaagcgccttgatgatttgtttgaaagagag
atcaaataccaagaagttttaaagctcaatgagatcaaatcctctatccttttgtggtta
gaaagcattcattaa

DBGET integrated database retrieval system