KEGG   Helicobacter pylori SouthAfrica7: HPSA_00975Help
Entry
HPSA_00975        CDS       T01921                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
hes  Helicobacter pylori SouthAfrica7
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:hes01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:hes01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:hes00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:hes00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
194539..195243
Genome map
AA seq 234 aa AA seqDB search
MTKIAMANFKSAMPIFKSHAYLKELEKTLKPQHCDKVFVFPDFLGLLPNAFLHFTLGAQN
AYPKDYGAFTGEITSKHLEELKINTLLIGHSERRVLLKESPSFLKEKFDFFKDKKFKIIY
CIGEDLKTREKGLGAVKEFLNEQLENIDLSYHHLIVAYEPIWAIGTKKSASLEDIYLTHG
FLKQILNQKTPLLYGGSVNTQNAKEILGIDSVDGLLVGSASLELENFKTIISFL
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaattgcaatggctaattttaaatccgctatgcctatttttaaaagccatgcg
tatttgaaagagttggaaaaaactttaaagccgcagcattgtgataaggtgtttgtattc
cctgattttttggggttattgcctaatgcgtttttgcatttcactttaggagcgcaaaac
gcttaccccaaagattatggggcttttacgggtgaaatcacttcaaagcatttagaagaa
ctcaaaatcaacacgcttttaatagggcatagcgagaggcgagtgcttttaaaggaaagc
cctagctttttgaaagaaaagtttgatttttttaaagataaaaaatttaaaatcatctat
tgtattggcgaagatttaaagaccagagaaaagggtttgggggctgtaaaagaattttta
aatgagcagttagaaaacattgatcttagttatcatcatttaatcgtggcttatgagcct
atttgggcgattggcacaaaaaaaagtgcatctttagaagatatttacctcacgcatggt
tttttaaagcaaatcttaaatcaaaaaacgcccttattgtatggggggagcgtgaacaca
caaaacgctaaagaaattttagggattgatagcgtggatggcttattggttgggagcgcg
tctttggaattagaaaattttaaaacaatcatttcatttttataa

DBGET integrated database retrieval system