KEGG   Helicobacter pylori SouthAfrica7: HPSA_01065Help
Entry
HPSA_01065        CDS       T01921                                 

Definition
(GenBank) succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
hes  Helicobacter pylori SouthAfrica7
Pathway
hes00300  Lysine biosynthesis
hes01100  Metabolic pathways
hes01120  Microbial metabolism in diverse environments
hes01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hes00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    HPSA_01065
Enzymes [BR:hes01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     HPSA_01065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer
Motif
Other DBs
NCBI-ProteinID: ADU84237
UniProt: E8QUL9
Position
complement(213388..214554)
Genome map
AA seq 388 aa AA seqDB search
MNALEITQKLISYPTITPKECGIFEYIKSLFPAFKTLECGENGVKNLFLYRIFNPLKKHA
EKEHAKEKHVKENVKPLHFCFAGHIDVVPPGNNWQSDPFKPIIKEGFLYGRGAQDMKGGV
GAFLSASLNFNPKTPFMLSILLTSDEEGPGIFGTRLMLEKLKEKDLLPHVAIVAEPTCEK
VLGDSIKIGRRGSINGRLILKGVQGHVAYPQKCQNPIDALASVLPLISGVHLDNGDECFD
PSKLVITNLHAGLGANNVTPASVEIIFNARHSLKTTKESLKEYLEKVLKDLPYTLELESS
SSPFITASHSKLASVLKENILKTCHTTPLLNTKGGTSDARFFSAHGIEVVEFGAINDRIH
AVDERVSLKELELLEKVFLGVLEGLSEK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaacgctttagaaatcacccaaaaactcatcagctaccccaccattacgcccaaagaa
tgcggtatttttgaatacattaaatcgctttttcctgcttttaaaaccctagagtgtggg
gaaaatggcgtgaaaaacctttttttataccgcatttttaaccccctcaaaaaacatgca
gaaaaagaacatgcaaaagaaaagcatgtaaaagaaaatgttaagcccttgcatttttgc
tttgcagggcatattgatgtcgtgcctcctgggaacaattggcaaagcgatccctttaaa
cccatcattaaagaggggtttttatacggccgtggggcgcaagacatgaaagggggcgtg
ggggcgtttttgagcgcgagtttaaattttaaccctaaaacccctttcatgctttctatt
ttactcacgagcgatgaagaaggaccggggatttttggcactaggcttatgctagaaaaa
ctcaaagaaaaggatttgttgccccatgtggcgattgtggctgaacccacttgcgaaaag
gtcttaggcgatagcatcaaaattggccgaagaggctctattaatggcagactcatttta
aaaggcgttcaagggcatgtggcttacccgcaaaaatgccaaaaccctattgacgcactc
gcttcggttttgcccttaatttcaggagttcatttagacaatggcgatgagtgttttgac
ccttcaaaattagtcatcaccaacttgcacgcagggttaggggcgaataatgttactccg
gcaagcgtagaaattattttcaatgcgcgccattctttaaaaaccactaaagagagtttg
aaagaatatttagaaaaggttttgaaagatttgccttatactttagaattagaatcaagc
agttcgcctttcatcacggcttcccattcaaagcttgccagcgttttaaaagaaaatatt
ttaaaaacatgccacaccaccccccttttaaacaccaaaggtggcacgagcgatgcacga
ttttttagcgctcacggcatagaagtggtggaatttggcgccattaatgacaggatccat
gccgttgatgaaagggtgagcttgaaggaactggagcttttagaaaaagtgtttttgggg
gttttagagggcttgagcgaaaaataa

DBGET integrated database retrieval system