KEGG   Helicobacter pylori SouthAfrica7: HPSA_01085Help
Entry
HPSA_01085        CDS       T01921                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
hes  Helicobacter pylori SouthAfrica7
Pathway
hes00900  Terpenoid backbone biosynthesis
hes01100  Metabolic pathways
hes01110  Biosynthesis of secondary metabolites
hes01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:hes00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HPSA_01085
Enzymes [BR:hes01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     HPSA_01085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXP_redisom_C DXPR_C
Motif
Other DBs
NCBI-ProteinID: ADU84241
UniProt: E8QUM3
Position
218986..220077
Genome map
AA seq 363 aa AA seqDB search
MVVLGSTGSIGRNALNIATKFGVEIEALSCGKNIALINEQIKVFKPKKVAILDPNDLKFL
EPLGAKVFVGLDGIDAMIEECASNLVLNAIVGVAGLKASFKSLQRNKKLALANKESLVSA
GHLLDISQITPVDSEHFGLWALLQNKVLKPKSLIISASGGAFRDTPLELIPTQGVQNALK
HPNWSMGSKITIDSASMVNKLFEVLETYWLFGASLKIDALIERNSIVHALVEFEDHSMIA
HLASADMKLPISYAINPKLASLSASIKPLDLYALGAIKFEPIDLERYTLWRYKDLLLENP
KLGVVLNASNEVAIKKFLNQEIAFGGLIQIISQALELYAKMPFKLSSLDEVLELDKEVRE
RLA
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atggttgttttaggaagcaccggctctattgggagaaacgcccttaatatcgcaacaaaa
tttggcgtagaaatagaggcgttgagttgcgggaaaaatatcgctttaatcaatgagcaa
atcaaagttttcaaacccaagaaagtggcgattttagatcctaacgatttgaaattctta
gagcctttgggcgcgaaagtgtttgtggggctagatggcattgatgcgatgatagaagag
tgcgcttccaatttagtccttaacgctattgtgggcgtggcaggattgaaagcgagcttt
aaaagcctacaaaggaataaaaaactagccctagcgaataaagaaagtttagtgagtgct
gggcatttattagacatttcacaaatcacgcccgttgatagcgagcattttggcttgtgg
gcgttgttgcaaaacaaggttttaaagcctaaatctttaatcattagcgcgagtgggggg
gcttttagggacacgcctttagaactaatccctactcaaggcgttcaaaacgcactcaag
caccctaattggagcatgggatctaaaatcaccattgattcagcgagcatggtcaataag
ctttttgaagttttagaaacttattggctttttggcgcgtctttaaagattgatgcactc
attgaaaggaattctatcgtgcatgctttagtggagtttgaagatcattctatgattgcg
catttagcgagtgcggacatgaaattacccataagctatgcgattaaccctaaattagct
tctttgagcgcttctatcaagcctttagacttatacgctttaggcgcgattaagtttgag
ccaattgatttagaacgctacactttgtggcgttataaagatttgctgttggaaaaccca
aagcttggcgtggtgctgaatgcgagcaatgaagtggcgataaagaagttcttgaatcaa
gaaatcgcctttggaggccttattcaaatcatttctcaagccttggaattatacgctaaa
atgcctttcaagctctctagtttagacgaagtgctggaattagacaaagaagttagggag
cgtttggcttaa

DBGET integrated database retrieval system