KEGG   Helicobacter pylori SouthAfrica7: HPSA_01170Help
Entry
HPSA_01170        CDS       T01921                                 

Definition
hypothetical protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
hes  Helicobacter pylori SouthAfrica7
Brite
Enzymes [BR:hes01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     HPSA_01170
Secretion system [BR:hes02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   HPSA_01170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
235985..236776
Genome map
AA seq 263 aa AA seqDB search
MILRASVLSALLLVGLGAAPKNLASNKQMQDNLVKVIEKQTNKKVRILEVKPLKSSQDLK
MVVVEDPDTKYNIPLVVSKDGNLVIGLSGIFFSNNSDDVKLLTETNQKILALNTTQQNSA
KLNAIFDEVPADYVIELPSTNAENKDKILYIVSDPMCPHCQKELTKLRDHLKENTVRMVV
VGWLGVNSAKKAALVQEEMAKARARGASVEDKISILEKIYSTQYDINAQKEPEDLRTKVE
NITKKIFESGVIKGVPFLYHYKA
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgatattaagagcgagcgtattgagcgcattacttcttgtaggtttaggggcagcccct
aaaaacctagcatctaataaacaaatgcaagacaatttagttaaggtgattgaaaaacaa
accaataaaaaggtgcgtattttagaagtcaaacctttgaaatccagccaggatttgaaa
atggtcgtagtagaagatccggacactaaatacaatatcccgcttgtagtgagcaaggat
ggtaatttagtcatagggcttagcggtatcttttttagcaataatagcgatgatgtgaag
ttgctcacagagaccaatcaaaaaatcctagcccttaacaccacccagcaaaatagcgcg
aaattgaacgctatttttgatgaagtgccggctgattatgtgatagagttgccttctact
aacgctgagaataaggacaaaatcctttatattgtctccgatcccatgtgcccgcattgc
caaaaagagctcactaaactcagagatcacttgaaagaaaacaccgtgagaatggttgta
gtggggtggcttggggtcaattcggctaaaaaagcggctttggttcaagaagaaatggcg
aaagctagggctaggggagcgagcgtggaagataaaatctctattcttgaaaagatttat
tccacccaatacgatattaacgcccaaaaagagcctgaagatttacgcactaaagtggaa
aatatcacgaaaaagatttttgaatcgggcgtgattaagggcgtgcctttcttataccat
tataaggcatag

DBGET integrated database retrieval system