KEGG   Helicobacter pylori SouthAfrica7: HPSA_03055Help
Entry
HPSA_03055        CDS       T01921                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
hes  Helicobacter pylori SouthAfrica7
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hes00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    HPSA_03055
   00052 Galactose metabolism
    HPSA_03055
   00500 Starch and sucrose metabolism
    HPSA_03055
   00520 Amino sugar and nucleotide sugar metabolism
    HPSA_03055
Enzymes [BR:hes01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     HPSA_03055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
626583..627404
Genome map
AA seq 273 aa AA seqDB search
MIKKCLFPAAGYGTRFLPITKTIPKEMLPIVDKPLIQYAVEEAMEAGCEVMAIVTGRNKR
SLEDYFDTSYEIEHQIQGTNKENALKSIRNIIEKCCFSYVRQKQMKGLGHAILTGEALIG
NEPFAVILADDLCISHDYPSVLKQMTSLYQKYQCSIVAIEEVALEEVSKYGVIRGELLEE
GVYEIKDMVEKPSQEDAPSNLAVIGRYILTPDIFEILSETKPGKNNEIQITDALLTQAKR
KRIIAYQFKGKRYDCGSVEGYIEASNAYYKKRL
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaaaatgcctttttcctgccgccggctatggcacgcgctttttgcccatcact
aaaaccattcctaaagaaatgctgcccattgtggataagcccttaatccaatacgccgta
gaagaagcgatggaggccggctgtgaagtgatggcgattgttacaggaagaaacaagcgc
agtttagaagattattttgacacgagctatgaaatagagcatcaaatccaaggcaccaac
aaagaaaacgctttaaaaagcattcgtaacattatagaaaaatgctgtttttcctatgtg
cgccaaaagcaaatgaaaggcttagggcatgcgattttaaccggggaagcccttataggc
aatgagccttttgcggtgattttagccgatgatttatgcataagccacgattacccaagc
gtgttgaagcaaatgacttcattgtatcaaaaataccaatgctctatcgtagccattgaa
gaagtggcgttagaagaagtttcaaaatacggcgtgattaggggcgaattgttagaagaa
ggggtgtatgagattaaagacatggtagaaaaaccaagccaagaagacgctccaagcaat
ttagccgtgatagggcgctatattttgaccccggatatttttgaaattttaagcgaaaca
aaaccgggtaaaaacaatgaaatccaaatcacagacgccttgctcactcaagccaaaaga
aaacgcatcatcgcttaccaattcaaaggcaaacgatacgattgcgggagcgtggaaggc
tatattgaagcgagcaacgcttattataaaaaacgcttataa

DBGET integrated database retrieval system