KEGG   Helicobacter pylori SouthAfrica7: HPSA_03065Help
Entry
HPSA_03065        CDS       T01921                                 

Definition
(GenBank) UDP-N-acetylglucosamine 1-carboxyvinyltransferase
  KO
K00790  UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
hes  Helicobacter pylori SouthAfrica7
Pathway
hes00520  Amino sugar and nucleotide sugar metabolism
hes00550  Peptidoglycan biosynthesis
hes01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hes00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    HPSA_03065
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    HPSA_03065
Enzymes [BR:hes01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     HPSA_03065
Peptidoglycan biosynthesis and degradation proteins [BR:hes01011]
 Precursor biosynthesis
  Transferase/Dehydrogenase
   HPSA_03065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EPSP_synthase DUF2730 7TM_GPCR_Srh
Motif
Other DBs
NCBI-ProteinID: ADU84616
UniProt: E8QVZ5
Position
627823..629091
Genome map
AA seq 422 aa AA seqDB search
MDFLEIVGQIPLKGGVGISGAKNSALPILAATLLSQQEVTISALPQVVDIKAMALLLQNL
GAELNWLSPNTLQISAKSLHHTEATYDLVRKMRASILVLGPLLARFKECLVSLPGGCAIG
ARPVDLHLKAMQQLGAEITIEQGYIHAKATKGLKGNDILFDKISVTGTENALMAASLAKG
ITRIINAAKEPEITQLCAFLQSGGVEIEGVGSSELKIRGVEGDALHLKDIQIIPDRIEAG
TYLCVGAITNSQLKINNIIPNHLQAITDKLIEIGFSLDIQKNSIEIYPAKKRQAFEITTK
EYPGFPTDMQAQFMALATQCLGTSVIEETLFENRFMHASELQRLGANISLKTNVATISGS
TELTGSDVMATDLRASSALILAALVAKGVSRVHRIYHLDRGYERLEDKINALGAKVLRLK
EK
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
ttggactttttagagattgtaggacaaatccctttaaaagggggggtgggaatttctggg
gctaaaaattccgctctccccattttagccgccacgcttttaagccaacaagaagttacc
atcagcgctttgccccaagtggtggatataaaggcgatggcgttattgttgcaaaattta
ggtgcagaattaaattggcttagtcctaacacgcttcaaatcagcgctaaatccttgcac
cacaccgaagccacttacgatttggtgcgtaaaatgcgcgcttctattttggttttaggc
ccgttattagcgcgttttaaggaatgtttagtgagtttgcccggtgggtgcgccatagga
gcaaggcctgtggatttgcacttaaaagcgatgcaacaattgggagcagaaatcacgatc
gagcaaggctatatccatgcaaaggctacaaagggcttaaaaggtaatgatattttattt
gataaaatcagcgttacaggcacagaaaacgccctcatggcagcaagtctagctaaaggg
ataacgcgcatcattaatgcagctaaagagccagagatcactcaattgtgcgcgttttta
cagagtgggggggtagaaattgagggtgttggcagcagcgagttaaagattaggggggta
gaaggcgatgctttgcatttaaaagacattcaaatcataccggataggattgaagcaggc
acttatttgtgcgtgggggctatcactaacagccagcttaaaattaataacattatccct
aaccacctccaagcgatcacggataagctcatagaaattggtttttcattagacattcaa
aaaaattccatagaaatttatccggccaaaaaacgccaagcttttgaaatcaccacgaaa
gaatacccgggctttcccacggatatgcaagcgcaattcatggcgttagctacgcagtgt
ttggggacgagcgtgattgaagaaacgctttttgaaaaccgcttcatgcatgcgagcgag
ttgcaacgcttgggggctaatatcagcctaaaaaccaatgttgctaccattagcggatcc
acagagcttaccggaagcgatgtgatggcgaccgatttaagggcttcttcagctctcatt
ttagccgctttagtggctaagggcgtgagtagggtgcataggatttaccacttggatagg
ggttatgagagattagaggataaaatcaacgctttaggggcaaaagtgttgcgtttaaaa
gaaaaataa

DBGET integrated database retrieval system