KEGG   Helicobacter pylori SouthAfrica7: HPSA_05360Help
Entry
HPSA_05360        CDS       T01921                                 

Gene name
glk
Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
hes  Helicobacter pylori SouthAfrica7
Pathway
hes00010  Glycolysis / Gluconeogenesis
hes00052  Galactose metabolism
hes00500  Starch and sucrose metabolism
hes00520  Amino sugar and nucleotide sugar metabolism
hes00521  Streptomycin biosynthesis
hes01100  Metabolic pathways
hes01110  Biosynthesis of secondary metabolites
hes01120  Microbial metabolism in diverse environments
hes01130  Biosynthesis of antibiotics
hes01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hes00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HPSA_05360 (glk)
   00052 Galactose metabolism
    HPSA_05360 (glk)
   00500 Starch and sucrose metabolism
    HPSA_05360 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    HPSA_05360 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    HPSA_05360 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    HPSA_05360 (glk)
Enzymes [BR:hes01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     HPSA_05360 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase
Motif
Other DBs
NCBI-ProteinID: ADU85046
UniProt: E8QST2
Position
1097982..1098992
Genome map
AA seq 336 aa AA seqDB search
MPKTETYPRLLADIGGTNARFGLEVAPRQIECIEVLPCNDFESLSDAVRFYLSKCKESLK
LRPTYGSFAVATPIMGDFVQMTNNHWTFSIETTRQCLGLERLLVINDFVAQAYAISAMQE
NDLAQVGGIKCEINAPKAILGPGTGLGVSTLIQNSDGSLKVLPGEGGHVSFAPFDDLEIL
VWQYARSKFNHVSAERFLSGSGLVLIYEALSKRKGLEKVAKLSKAELTPQIISERALNGD
YPICRLTLDTFCSMLGTLAADVALTLGARGGVYLCGGIIPRFIDYFKTSPFRVRFETKGR
MGAFLASIPVHVVLKKTPGLDGAGIALENYLLHDKI
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaaactgaaacttacccaagactcttagccgatattggcggcacaaacgcgcgc
tttggtttggaagtcgccccacgacaaattgaatgcattgaagttttaccatgtaacgat
tttgaaagcttgagcgatgcggtgcggttttatctttctaaatgcaaagaaagccttaaa
ttacgccctacttatggctcttttgctgtggctacgcccattatgggggattttgtccaa
atgacgaacaaccactggactttttccattgaaacgacacggcaatgtttaggattagaa
aggttgcttgtcatcaatgattttgtcgcgcaagcctatgccattagcgcgatgcaagaa
aacgatctggctcaagtgggcgggatcaagtgcgaaatcaacgcccctaaagcgatttta
gggccaggaaccgggcttggggtaagcactcttattcaaaacagcgatggctctttgaaa
gtcttgcccggtgaaggagggcatgtgagttttgccccttttgatgatttggaaatttta
gtgtggcaatacgcccgctctaaattcaaccatgtgagcgcggaaaggtttttgagcggg
agcggcctagtattgatttatgaagccctatccaagcgcaaaggcttagaaaaagtggct
aaattgagtaaggctgaattgaccccacaaatcattagcgaacgcgctttgaatggggat
taccctatatgccgattgaccttggacactttttgctccatgcttggcacgctcgctgct
gatgtggctctcactttgggcgctagaggcggggtgtatttgtgtggggggattatccca
cgattcattgactattttaaaacttcgccctttagagtgcgttttgaaacgaaagggcgc
atgggagcgtttctcgcttctatccctgtgcatgtcgtgttgaaaaaaactcccgggctt
gatggggcaggcattgcgttagagaattatttactgcatgataaaatataa

DBGET integrated database retrieval system