KEGG   Helicobacter pylori SouthAfrica7: HPSA_05390Help
Entry
HPSA_05390        CDS       T01921                                 

Definition
(GenBank) pyruvate flavodoxin oxidoreductase subunit gamma
  KO
K00172  pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
hes  Helicobacter pylori SouthAfrica7
Pathway
hes00010  Glycolysis / Gluconeogenesis
hes00020  Citrate cycle (TCA cycle)
hes00620  Pyruvate metabolism
hes00640  Propanoate metabolism
hes00650  Butanoate metabolism
hes00680  Methane metabolism
hes01100  Metabolic pathways
hes01120  Microbial metabolism in diverse environments
hes01130  Biosynthesis of antibiotics
hes01200  Carbon metabolism
Module
hes_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hes00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HPSA_05390
   00020 Citrate cycle (TCA cycle)
    HPSA_05390
   00620 Pyruvate metabolism
    HPSA_05390
   00640 Propanoate metabolism
    HPSA_05390
   00650 Butanoate metabolism
    HPSA_05390
  Energy metabolism
   00680 Methane metabolism
    HPSA_05390
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    HPSA_05390
Enzymes [BR:hes01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     HPSA_05390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR MAF_flag10
Motif
Other DBs
NCBI-ProteinID: ADU85052
UniProt: E8QST8
Position
1105186..1105746
Genome map
AA seq 186 aa AA seqDB search
MFQIRWHARAGQGAITGAKGLADVISKTGKEVQAFASYGSAKRGAAMMAYNRIDDEPILN
HERFMQPDYVLVIDPGLVFIENIFANEKEDTTYIITSYLSKEELFEKKPELKTRKVFLVD
CLKISMETLKRPIPNTPMLGALMKVSGMLEIGAFKEAFKKVLGKKLTQEVIDANMLAIQR
AYEEVQ
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgtttcaaattagatggcatgcacgagctggtcaaggtgctatcaccggtgctaaaggg
ctagctgatgtgatttcaaaaacaggtaaagaagtgcaagcgttcgcttcttatggttca
gccaaaaggggggcggctatgatggcttataaccgcattgatgatgagccgattttaaac
catgagcgcttcatgcagcctgattatgtgctagtgattgatccgggtttggttttcatt
gaaaatattttcgctaatgaaaaagaagacaccacttacattatcaccagttacctcagc
aaagaagagttgtttgaaaaaaaacctgaattaaaaacccgtaaggtgtttttggtggat
tgcttaaaaatctctatggaaaccttaaaacgccccattcctaacacgcccatgctaggg
gcgttaatgaaagtgtctggcatgcttgaaattggggcttttaaagaagcttttaagaaa
gttttaggcaaaaaactcactcaagaagtcattgacgctaacatgctcgctatccaaaga
gcttatgaagaagttcaataa

DBGET integrated database retrieval system