KEGG   Helicobacter pylori SouthAfrica7: HPSA_05395Help
Entry
HPSA_05395        CDS       T01921                                 

Gene name
porD
Definition
(GenBank) pyruvate flavodoxin oxidoreductase subunit delta
  KO
K00171  pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
hes  Helicobacter pylori SouthAfrica7
Pathway
hes00010  Glycolysis / Gluconeogenesis
hes00020  Citrate cycle (TCA cycle)
hes00620  Pyruvate metabolism
hes00640  Propanoate metabolism
hes00650  Butanoate metabolism
hes00680  Methane metabolism
hes01100  Metabolic pathways
hes01120  Microbial metabolism in diverse environments
hes01130  Biosynthesis of antibiotics
hes01200  Carbon metabolism
Module
hes_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hes00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HPSA_05395 (porD)
   00020 Citrate cycle (TCA cycle)
    HPSA_05395 (porD)
   00620 Pyruvate metabolism
    HPSA_05395 (porD)
   00640 Propanoate metabolism
    HPSA_05395 (porD)
   00650 Butanoate metabolism
    HPSA_05395 (porD)
  Energy metabolism
   00680 Methane metabolism
    HPSA_05395 (porD)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    HPSA_05395 (porD)
Enzymes [BR:hes01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     HPSA_05395 (porD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4 Fer4_21 Fer4_6 Fer4_10 Fer4_2 Fer4_7 Fer4_9 Fer4_17 Fer4_16 Fer4_15 Fer4_13 Fer4_8 Fer4_4 Fer4_22 Fer4_3
Motif
Other DBs
NCBI-ProteinID: ADU85053
UniProt: E8QST9
Position
1105762..1106154
Genome map
AA seq 130 aa AA seqDB search
MKDWNEFEMGAVLFPFEKNAQSEMEKHNDERHYTEQSYFTTSVAHWRVAKPVHNNNICIN
CFNCWVYCPDAAILSREGKLKGVDYSHCKGCGVCVDVCPTNPKSLWMFEEQIEPATALTQ
WPQKQEKKKS
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgaaagattggaatgaatttgaaatgggagcggtgctcttcccttttgaaaaaaacgca
caaagcgaaatggaaaaacacaacgatgagcgccattacaccgagcaaagctacttcacc
acttcagtggctcattggcgtgtggctaagcctgtgcataacaataacatttgcatcaat
tgctttaattgttgggtttattgcccagatgcggctattctttcaagagagggcaagtta
aagggcgtggattattctcattgtaagggctgtggcgtgtgcgtggatgtctgccccacc
aaccctaaatcgctatggatgtttgaagagcaaattgaacctgccaccgcactcactcaa
tggccgcaaaaacaagaaaagaaaaaatcgtaa

DBGET integrated database retrieval system