KEGG   Helicobacter pylori SouthAfrica7: HPSA_06050Help
Entry
HPSA_06050        CDS       T01921                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
hes  Helicobacter pylori SouthAfrica7
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hes00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    HPSA_06050
Enzymes [BR:hes01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     HPSA_06050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1243355..1244497
Genome map
AA seq 380 aa AA seqDB search
MTLKRLNPDALKNALQKIGPEKIAQDRMHQKGVSLIFEIQHLPLSAALILKQEAISVGGD
FATPKDCILAKEPFYDGVLIVSASQLERLIVKCYSQPFGLKHLAQELKSHLKAPKPNAPQ
IMAILNLTPDSFYAKSRFNSKKALEEVYQLLEKGITLIDIGAASSRPQSEIIDPKIEQER
LKEVLLEIKSQKLYQFARFSIDTYHAKTARMALEHHFSILNDVSGFSSVEMLEVARDYKP
TCILMHAQKTPKDMQENVFYYNLFDEMDRFFKDKLEVLEKYALQDIVLDIGFGFAKLKEH
NLALIKHLSHFLKFKKPLLVGASRKNTIGLITGREVQNRLAGTLSLHLMALQNGASVLRA
HDIDEHIDLIKVFKSLEETD
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgaccttaaaacgccttaaccctgatgcgttaaaaaacgccctccaaaaaataggccca
gaaaagatcgcgcaagatcgcatgcaccaaaaaggcgttagtttgatctttgaaatccaa
catttgcccttaagcgctgcattgattttaaagcaagaagccatcagcgttgggggcgat
tttgccacgccaaaagattgtattttggctaaagagcctttttatgatggggtgttgatt
gtgagcgctagccaattagaacgcttgattgtgaagtgttactcccaaccctttgggctt
aaacatttagcgcaagaattgaaaagccacctcaaagcccctaaacctaacgccccacag
atcatggcaattttaaacctcacaccggatagtttctatgcaaagagccgttttaatagc
aaaaaagcgcttgaagaggtttatcaattattggaaaaaggcatcacgctcattgatata
ggcgcggccagttcaaggccacagagtgaaatcattgatccaaaaatagagcaagagcgc
ttgaaagaagttttactagaaatcaaatcccaaaaactctaccaattcgcgcgattcagc
atagacacctaccatgccaaaaccgcccgaatggctttggagcatcatttttctatcctt
aatgatgtgagcggttttagtagcgttgaaatgctagaagtcgcaagagattacaaaccc
acttgcattttaatgcacgctcaaaaaacccccaaagacatgcaagaaaatgtgttttat
tacaatctgtttgatgaaatggatcgcttttttaaagacaagctagaagttttagaaaaa
tacgcgcttcaagatattgttttggatattgggtttggattcgctaaattaaaagagcat
aatctagccttaatcaagcatttgagccactttctcaaattcaaaaaacccttattggtg
ggagcgagccgtaaaaacaccatcgggcttatcactgggcgtgaagttcaaaaccgactc
gctggcactttaagcttgcatttaatggcgttgcaaaatggagcgagcgttttaagagcg
catgatattgatgaacatattgatctcattaaagtgtttaaaagcttggaagaaacggat
taa

DBGET integrated database retrieval system