KEGG   Helicobacter pylori SouthAfrica7: HPSA_06270Help
Entry
HPSA_06270        CDS       T01921                                 

Definition
(GenBank) hypothetical protein
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
hes  Helicobacter pylori SouthAfrica7
Pathway
hes00010  Glycolysis / Gluconeogenesis
hes00030  Pentose phosphate pathway
hes00051  Fructose and mannose metabolism
hes00052  Galactose metabolism
hes00230  Purine metabolism
hes00500  Starch and sucrose metabolism
hes00520  Amino sugar and nucleotide sugar metabolism
hes00521  Streptomycin biosynthesis
hes01100  Metabolic pathways
hes01110  Biosynthesis of secondary metabolites
hes01120  Microbial metabolism in diverse environments
hes01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:hes00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HPSA_06270
   00030 Pentose phosphate pathway
    HPSA_06270
   00051 Fructose and mannose metabolism
    HPSA_06270
   00052 Galactose metabolism
    HPSA_06270
   00500 Starch and sucrose metabolism
    HPSA_06270
   00520 Amino sugar and nucleotide sugar metabolism
    HPSA_06270
  Nucleotide metabolism
   00230 Purine metabolism
    HPSA_06270
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    HPSA_06270
Enzymes [BR:hes01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     HPSA_06270
    5.4.2.8  phosphomannomutase
     HPSA_06270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_III PGM_PMM_II PGM_PMM_IV
Motif
Other DBs
NCBI-ProteinID: ADU85222
UniProt: E8QTA8
Position
1288714..1290090
Genome map
AA seq 458 aa AA seqDB search
MDISIFREYDIRGIYPTTLDEKSAFSIGVELGKIMREYDNSVFVGHDARVHGRFLFEALS
AGLQSSGLKVYDLGLIPTPVAYFAAFNAINGIQCPNSIMITGSHNPKEYNGFKITLNQNP
FYGKEIQALKDTLLSVKHEMQPLKETPEKINALEAYQRYLIKDFKHLESIQYKIALDFGN
GVGALGLEPILKALNIEFSSLYSDPDGNFPNHHPDPSEAKNLQDLEKHMQKNAIPIGFAF
DGDADRIAMLSSNHNYAGDELAILFAKRLHAQGITPFVIGEVKCSQVMYDTINAFGKTLM
YKTGHSNLKIKLKETNAHFAAEMSGHIFFKERYFGYDDALYACLRALELLLEQSPSDLEN
TIKNLPYSYTTPEEKIAVSEEEKFEIIHNLQEALKNPPSHFPKIKEMINLDGVRVVFEHG
FGLIRASNTTPYLVTRFEGKDEKTALEYKRALLNLLEQ
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atggacattagcatttttagagaatacgatattagaggcatttaccccactactttagac
gaaaagagcgcttttagtatcggcgtggagttagggaaaatcatgcgagaatacgataat
agcgtgtttgtagggcatgacgcaagggtgcatgggcgttttttgtttgaagctttgagc
gcggggttgcaatcaagtggcttgaaagtgtatgatttggggctaatccccacaccggta
gcgtattttgcggcttttaatgcaatcaatggtatccaatgccctaattctatcatgatc
accggctctcacaaccccaaagaatacaacggctttaaaatcacgctcaatcaaaacccg
ttttatggcaaggagattcaagctttaaaagacacgcttttaagcgttaaacacgaaatg
caacccttaaaagaaacgccagaaaaaatcaatgccctagaagcgtatcagcgctacttg
atcaaggattttaagcatttagaaagtattcaatacaagatcgctttagattttggtaat
ggcgtgggagcgttagggctagagccgattttaaaggctttaaacattgaatttagcagc
ctttatagcgatcctgatggcaatttccctaaccaccacccagaccctagcgaagcgaaa
aacttacaggatttagaaaagcacatgcaaaaaaacgctattcccataggctttgctttt
gatggcgatgcagacaggattgcgatgctaagctctaaccacaactatgcgggcgatgaa
ttagcgatattatttgctaaacgcttgcatgctcaaggcattaccccttttgtgataggc
gaagtcaaatgctcccaagtgatgtatgacacgattaacgcttttggtaagacgctcatg
tataaaaccgggcatagcaatttaaaaatcaagcttaaagaaaccaatgcgcattttgcg
gctgagatgagcgggcatatcttttttaaggaacgctattttggctatgatgacgctctt
tatgcatgtttaagggctttagaattattgcttgaacaaagtccaagcgatttggaaaac
accattaaaaacctcccctattcttacaccacgcctgaagaaaaaatcgccgtgagcgaa
gaagaaaaatttgaaatcattcataacttgcaagaagcgcttaaaaacccgccaagccat
ttccctaaaatcaaagaaatgattaaccttgatggcgtgagagtggtttttgaacatggt
tttggactcattcgtgcaagcaacaccacgccctatttagtcactcgctttgaaggcaaa
gatgaaaaaacggcattagaatataaaagggcgttgctcaatttattagagcaataa

DBGET integrated database retrieval system