KEGG   Helicobacter pylori SouthAfrica7: HPSA_06280Help
Entry
HPSA_06280        CDS       T01921                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase subunit alpha
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
hes  Helicobacter pylori SouthAfrica7
Pathway
hes00260  Glycine, serine and threonine metabolism
hes00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hes01100  Metabolic pathways
hes01110  Biosynthesis of secondary metabolites
hes01130  Biosynthesis of antibiotics
hes01230  Biosynthesis of amino acids
Module
hes_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hes00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HPSA_06280 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HPSA_06280 (trpA)
Enzymes [BR:hes01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HPSA_06280 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth PcrB ThiG AMIN NanE
Motif
Other DBs
NCBI-ProteinID: ADU85224
UniProt: E8QTB0
Position
complement(1291164..1291952)
Genome map
AA seq 262 aa AA seqDB search
MRYQNMFETLKKQEKMAFIPFVTLGDPNYGLSFEIVKTLMASGASALELGFAFSDPVADG
ATIQASHLRALKHASMAKNFQLLKKIRGYNPHIPIGLLAYANLIFSYGVDGFYAQAKECG
IDSVLIADMPLIEKELVIKSAQKHQIKQIFIVSPNASVKDLEQVALNSQGYIYTLARSGV
TGASHTLENDATTIIKTLKTFSSTPALLGFGISKKEHIKNAKDMGADGVICGSALVKIIE
ENLNNENAMLEKIKRFVGEMVS
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgaggtatcaaaacatgtttgaaactttaaaaaaacaagaaaaaatggcgtttatccca
tttgtaaccttgggcgatcctaattatggactgagttttgaaatcgttaaaactttaatg
gctagcggtgcgagcgctttggagttaggttttgctttctcagatcccgtagcggatggc
gccactatacaagcgagccatttaagggcgttaaaacacgcttctatggctaaaaatttc
caacttttaaaaaaaattaggggttataatcctcatatccctatagggcttttagcgtat
gcgaatttaattttttcttatggcgttgatggcttttacgctcaagctaaagaatgcggt
atagacagcgttttaatagcggacatgcccctgatagaaaaggaattagtcatcaaatcc
gctcaaaaacatcaaattaaacaaatctttatcgttagtcctaatgcgagcgttaaggat
ttagaacaagtcgccctaaattcgcaaggctatatttacactttagccaggagtggggtt
actggggcgagtcataccttagaaaatgatgcaaccactatcattaaaaccttaaaaact
tttagctctacccctgcgttactaggctttggcatttctaaaaaagaacacatcaaaaac
gctaaagacatgggcgctgatggcgtgatttgcggctcagcgttagtcaaaatcatagaa
gaaaatttgaataatgaaaacgccatgctggaaaaaattaagaggtttgtaggagaaatg
gtttcttga

DBGET integrated database retrieval system