KEGG   Helicobacter pylori SouthAfrica7: HPSA_06280Help
Entry
HPSA_06280        CDS       T01921                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase subunit alpha (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
hes  Helicobacter pylori SouthAfrica7
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hes00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HPSA_06280 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HPSA_06280 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HPSA_06280 (trpA)
Enzymes [BR:hes01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HPSA_06280 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1291164..1291952)
Genome map
AA seq 262 aa AA seqDB search
MRYQNMFETLKKQEKMAFIPFVTLGDPNYGLSFEIVKTLMASGASALELGFAFSDPVADG
ATIQASHLRALKHASMAKNFQLLKKIRGYNPHIPIGLLAYANLIFSYGVDGFYAQAKECG
IDSVLIADMPLIEKELVIKSAQKHQIKQIFIVSPNASVKDLEQVALNSQGYIYTLARSGV
TGASHTLENDATTIIKTLKTFSSTPALLGFGISKKEHIKNAKDMGADGVICGSALVKIIE
ENLNNENAMLEKIKRFVGEMVS
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgaggtatcaaaacatgtttgaaactttaaaaaaacaagaaaaaatggcgtttatccca
tttgtaaccttgggcgatcctaattatggactgagttttgaaatcgttaaaactttaatg
gctagcggtgcgagcgctttggagttaggttttgctttctcagatcccgtagcggatggc
gccactatacaagcgagccatttaagggcgttaaaacacgcttctatggctaaaaatttc
caacttttaaaaaaaattaggggttataatcctcatatccctatagggcttttagcgtat
gcgaatttaattttttcttatggcgttgatggcttttacgctcaagctaaagaatgcggt
atagacagcgttttaatagcggacatgcccctgatagaaaaggaattagtcatcaaatcc
gctcaaaaacatcaaattaaacaaatctttatcgttagtcctaatgcgagcgttaaggat
ttagaacaagtcgccctaaattcgcaaggctatatttacactttagccaggagtggggtt
actggggcgagtcataccttagaaaatgatgcaaccactatcattaaaaccttaaaaact
tttagctctacccctgcgttactaggctttggcatttctaaaaaagaacacatcaaaaac
gctaaagacatgggcgctgatggcgtgatttgcggctcagcgttagtcaaaatcatagaa
gaaaatttgaataatgaaaacgccatgctggaaaaaattaagaggtttgtaggagaaatg
gtttcttga

DBGET integrated database retrieval system