KEGG   Helicobacter pylori SouthAfrica7: HPSA_06285Help
Entry
HPSA_06285        CDS       T01921                                 

Definition
(GenBank) tryptophan synthase subunit beta (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
hes  Helicobacter pylori SouthAfrica7
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hes00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HPSA_06285
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HPSA_06285
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HPSA_06285
Enzymes [BR:hes01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HPSA_06285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1291949..1293130)
Genome map
AA seq 393 aa AA seqDB search
MNKKAYFGEFGGSFVSELLVPALRELEQAFDACLKDDQFQQEYFNLLKDFVGRPSPLTLC
QNIVSNPKVKLYLKREDLIHGGAHKTNQALGQALLAKKMGKTRIIAETGAGQHGVATAIA
CALLNLKCVIFMGSKDIKRQEMNVFRMHLLGAEVREVNSGSATLKDAVNEALRDWASSYK
DTHYLLGTAAGPHPYPTMVKTFQKMIGDEVKQQILEKENRLPDYVIACVGGGSNAIGIFS
AFLNDKEVKLIGVEPAGLGLETNKHGATLNKGRVGILHGNKTYLLQDNEGQIAESHSISA
GLDYPGVGPEHSFLKESGRAIYESASDNEALEAFRLLCQKEGIIPALESSHALAYALKLA
QKCTQESVIVVNLSGRGDKDLNTVYNALKGGLK
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaaaagcgtattttggggaatttggggggagttttgtttccgaattgttagtg
cctgcgttaagggagttagaacaggcgtttgatgcgtgtttgaaagacgatcaattccaa
caagagtattttaaccttttaaaggattttgtgggccgtcctagccctttaactttgtgt
caaaatatcgtttctaaccctaaagttaagctttatttgaaacgagaggatttaatccat
ggcggggcgcataagactaaccaggcgttagggcaagcccttttggcgaaaaaaatgggg
aaaactaggatcattgctgaaacaggcgctgggcagcatggcgttgcaacggctatcgct
tgcgcgttattgaatttaaaatgcgtgatttttatgggaagtaaagacatcaagcgccaa
gaaatgaatgtttttagaatgcacttattaggcgctgaagtgagagaagtcaattcaggg
agcgcgacgcttaaagacgctgtgaatgaggccttaagagattgggcgagcagttacaaa
gacacgcactatttgctaggcacagccgccggaccgcacccttaccctacgatggtcaaa
acctttcaaaaaatgataggcgatgaggtcaagcaacaaattttagaaaaagaaaaccgc
ttgcctgattatgttatcgcatgcgttggaggggggtctaacgccatagggatattcagc
gcgtttttaaacgataaagaggttaaactcataggcgtagagccggcaggcttgggtcta
gaaaccaataagcatggagcgactttgaataaggggcgagtggggattttgcatgggaat
aaaacctatcttttgcaagataatgagggtcaaattgcagaaagccatagcattagcgcc
gggcttgattatccgggagtggggccagagcatagctttttaaaagagagcgggcgcgcg
atttatgaaagcgcaagcgataatgaagcgctagaagctttcaggttgttatgccaaaaa
gaaggcattatcccggcgttagaaagctcacacgccttagcgtatgctttaaagctcgct
caaaaatgcacgcaagaaagcgttattgtagtgaatttgagcggtaggggggataaggat
ttgaataccgtttataacgctttaaaagggggtttgaaatga

DBGET integrated database retrieval system