KEGG   Helicobacter pylori SouthAfrica7: HPSA_06815Help
Entry
HPSA_06815        CDS       T01921                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
hes  Helicobacter pylori SouthAfrica7
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:hes00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1379196..1380002
Genome map
AA seq 268 aa AA seqDB search
MTHAFEVYPKVNIFLKILYKEGAYHKLISRMCLVKGQLKDIISVKNASSFSLKGNFDCPL
EENSLFRVLQILKKFLKSKNPPNPIIKSLDTLAVEVEKNIPTQAGLGGGSADAGGLLHHL
NQIFDLRLNLEELYTIGSLVGADTNFFISQHKSANATSYGEIIENFEEEPLEDRLEIYAP
DNIFCSTKAVYQAYKPQTCFSQAKEWLKKPSLECLKTCDRNELNDLLKPALLTNQALKDT
ESQLGKEWFFSGSGSAFFRLKPTPKGIA
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
ttgacgcatgcttttgaagtttatcctaaagtcaatatttttttaaaaatcctttacaaa
gaaggggcatatcataagctcatttctcgcatgtgtttagtcaaaggccagctaaaagac
attatcagcgttaaaaacgcctcatctttctcattaaaagggaattttgactgcccttta
gaagaaaactcgctttttagggttcttcaaattttaaaaaaatttttaaaatcaaaaaat
cccccaaatcctatcatcaaatccctagacaccctagcggttgaagtggaaaaaaacatc
cccactcaagccgggttaggcggtgggagcgctgatgctggggggctattgcatcattta
aatcaaatttttgatttgcgcttgaatttagaagagctttatactatcggctctttagtg
ggtgcggacactaattttttcatctcgcaacacaagagcgctaacgccacttcttatggc
gaaatcattgaaaattttgaagaagagcctttagaagatcgcctagaaatctatgcgccg
gacaatattttttgcagcaccaaagccgtttatcaagcttataagccccaaacttgtttt
tcccaagctaaagaatggcttaaaaaaccgagtttagagtgcttaaaaacttgcgatagg
aatgagcttaacgatcttttaaaaccggctttactcactaaccaagccttaaaggataca
gaaagccaattaggcaaggaatggttttttagcgggagcgggagcgcgttttttaggcta
aagcccactccaaaagggattgcatga

DBGET integrated database retrieval system