KEGG   Helicobacter pylori Puno135: HPPN135_00500Help
Entry
HPPN135_00500     CDS       T01920                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
heu  Helicobacter pylori Puno135
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:heu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HPPN135_00500
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HPPN135_00500
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    HPPN135_00500
Enzymes [BR:heu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     HPPN135_00500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(96816..98276)
Genome map
AA seq 486 aa AA seqDB search
MPFAPTRSLKEKKIDFIEAILNPNAPKGGLYTLEHFETLEWQDCLNLSYNELVECVFERL
GLEIPKGLLTSALKRYENFDNPKNPAPIFALNERLFVQELYHGPSLAFKDMALQPLASLF
SNLAVGKNEKYLMLVSTSGDTGPATLESLAGMPNVFVVCLYPKDGTSLVQKLQMVTQSAS
NLKVFGISGDFDDAQNALKNLLKDDDFNNALKACQLKLSVANSVNFGRIAFQIVYHIWGF
LELYKKGAINSKEKITLAIPSGNFGNALGAFYAKKMGLNIAKIKVVTNSNDVLREFIETG
RYDLTHRSLKQTYSPAMDILKSSNVERVLFDLFGFERTLEWMQALEEEKFYALKPKELAL
LQEHFSCASCSDEACLKTIQKVYAEHQYLIDPHTATALNASLKTNEKTLVSATASYEKFP
STTLLALSDQKKNDNDKTALETLKNSYNTPDSQRLDDLFEKGIKHQEVLKLNEIKSSILL
WLENTH
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgccttttgcccccacgcgttctttgaaagaaaaaaagattgattttattgaagcgata
ttaaaccccaacgccccaaaaggcgggctttacactttagagcattttgaaacattagaa
tggcaggattgtttgaatctgagctataacgagctggtagaatgcgtgtttgagcggttg
ggtttagagattcctaagggtttattaacaagcgctttaaaacgctatgaaaattttgat
aaccctaaaaatccagcccctatttttgcgctcaatgaaaggctttttgtccaagagctc
taccatgggcctagtttggcgtttaaagacatggcgttacagcctttagcgagcttgttt
tctaatctagcggtaggaaaaaatgaaaagtatttaatgctcgtttctaccagtggcgat
accggccctgcgactttagaaagtttggcgggcatgcctaatgtttttgtggtgtgttta
taccccaaagacggcacaagtttagtccaaaaactccaaatggttacccaaagcgctagc
aatttaaaggtctttgggatcagtggggattttgatgatgcgcaaaacgcgctcaaaaac
cttttaaaagacgatgattttaacaacgctttaaaagcgtgccaattaaaattaagcgtg
gctaattccgtgaattttgggcgcatcgcttttcaaatcgtctatcatatttggggcttt
ttagaattgtataaaaaaggcgcgatcaattctaaagaaaaaatcaccctagccatacct
agcggtaattttgggaacgcattaggagcgttttatgccaaaaaaatgggcttgaatatt
gctaaaatcaaggttgtaaccaacagcaatgatgttttaagggagtttatagaaacaggg
cgttacgatttaacccatcgttctttaaaacaaacctactcgccggctatggatatttta
aaaagctctaatgtggaaagggtgctttttgacctctttgggtttgaacgcacgctagaa
tggatgcaagctttagaagaagagaaattttatgcattaaagcctaaagaattagccctt
ttacaggagcatttttcttgcgcaagctgctcagatgaagcctgtttgaaaacaatccaa
aaagtttatgcagagcaccaatacctgattgaccctcacaccgccaccgctttaaacgct
agcttgaaaactaatgaaaaaacccttgtttctgccaccgcctcttatgaaaaattcccc
agcaccacccttttagccctaagcgatcaaaagaaaaacgataacgacaaaaccgcccta
gaaacgcttaaaaacagctacaataccccagatagccagcgccttgatgatttatttgag
aaaggaatcaagcaccaagaggttttaaaactcaatgagatcaaatcttctatccttttg
tggctagaaaacacgcattaa

DBGET integrated database retrieval system