KEGG   Helicobacter pylori Puno135: HPPN135_00815Help
Entry
HPPN135_00815     CDS       T01920                                 

Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
heu  Helicobacter pylori Puno135
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:heu00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(161293..162264)
Genome map
AA seq 323 aa AA seqDB search
MFKRLRRLRSSENLRAMIRETRLNIDDFIAPLFVIESDSYIKNEINSMPGVYQMSVESLL
KECEELVGLGIKAVLLFGIPKNKDATGSHALNKDHIVAKATKEVKKRFKDLIVIADLCFC
EYTDHGHCGILENASVSNDKTLEILNLQGLILAESGVDILAPSNMMDGNVLSLRKTLDNA
GYFYTPIMSYSTKFASSYYGPFRDVANSAPSFGDRKSYQMDYANKKEALLESLEDEKQGA
DILMVKPALAYLDIVKEIRDHTLLPLALYNVSGEYAMLKLAQKHNLINYESVLLETMTCF
KRAGADMVISYHAKEVANLLQRN
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgttcaaacgattgagaagattacgaagcagcgaaaacttaagagcgatgataagagaa
acgcgtctgaatattgatgatttcatcgctcccttatttgtcatagaaagcgatagttat
attaaaaatgaaatcaactccatgcctggcgtttatcaaatgagtgtagagtctctttta
aaagaatgcgaagaattagtgggtttaggcatcaaagccgttttattgtttggcattcct
aaaaataaggacgctacaggaagccatgcgttaaataaggatcacattgtcgcaaaagcc
accaaagaggttaaaaaacgatttaaggatttaatcgttatagcggatttgtgtttttgt
gaatacaccgaccatgggcattgcgggattttagaaaacgcttctgtgtctaacgataaa
acgctagagattttaaaccttcaagggcttattttggctgaaagcggtgtggatattcta
gccccaagcaacatgatggatgggaatgttttgagcttgagaaaaacgctagataacgcc
ggctatttttacacgcccatcatgagctattccactaaatttgcgagcagttactatggg
ccttttagagatgtggcaaactctgcaccgagttttggcgatcgcaaaagctatcaaatg
gattacgctaataaaaaagaagcgcttttagaaagtttagaagatgaaaaacagggtgcg
gatattttaatggtgaaaccggctttggcgtatttggatattgttaaagaaatcagagat
cacactttgctccctttagcgctctataatgtgagcggggaatacgccatgctcaaactc
gctcaaaaacacaacctgatcaactatgaaagcgttttattagaaacgatgacttgtttt
aaaagagcgggagcggatatggttattagctatcatgctaaagaagtggctaacttatta
caaaggaattga

DBGET integrated database retrieval system