KEGG   Helicobacter pylori Puno135: HPPN135_01425Help
Entry
HPPN135_01425     CDS       T01920                                 

Definition
hypothetical protein
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
heu  Helicobacter pylori Puno135
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:heu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HPPN135_01425
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HPPN135_01425
Enzymes [BR:heu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     HPPN135_01425
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
274167..274709
Genome map
AA seq 180 aa AA seqDB search
MQEIGILENLQKSLALKEGMLSYEMLGKSLSYNPYLPRIISKTKDCVFVTPDEVLGKLLE
ENARTDCVIVNFKGLYEIGTPSVFDLEVLGLLRRHASSLIVHQDLFISHYQLLESLVQGS
DGVILDEELLKEDLKGMAEFAWRLGLSVFVETHKLDYTHLKDLGVLGVLEKVPHSQNQKK
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaaatagggattttagaaaatttacaaaaaagcttagccttaaaagagggcatg
ctttcttatgaaatgctgggtaaaagcctgtcgtataacccttacttgcctagaattatt
tctaaaaccaaagattgtgtttttgtaactcctgatgaggttttaggaaagcttttggaa
gaaaacgcccgcaccgattgtgtcattgttaatttcaaaggattatacgaaataggcaca
ccaagcgtgtttgatctagaagttttagggttattgcgccgccatgcgagctctttgatt
gtccatcaggatcttttcatcagccattaccagcttttagaatcgcttgttcaaggctct
gatggggtcattttagacgaagagcttttgaaagaagatttaaagggcatggcagaattc
gcttggcgtttgggcttaagcgtgtttgtagaaacccacaagttagactacacccattta
aaagatttaggggttttaggcgtgttagaaaaagtcccccattctcaaaatcaaaaaaaa
tag

DBGET integrated database retrieval system