KEGG   Helicobacter pylori Puno135: HPPN135_03190Help
Entry
HPPN135_03190     CDS       T01920                                 

Definition
UTP--glucose-1-phosphate uridylyltransferase subunit GalU
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
heu  Helicobacter pylori Puno135
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:heu00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    HPPN135_03190
   00052 Galactose metabolism
    HPPN135_03190
   00500 Starch and sucrose metabolism
    HPPN135_03190
   00520 Amino sugar and nucleotide sugar metabolism
    HPPN135_03190
Enzymes [BR:heu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     HPPN135_03190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
646817..647638
Genome map
AA seq 273 aa AA seqDB search
MIKKCLFPAAGYGTRFLPITKTIPKEMLPIVDKPLIQYAVEEAMEAGCEVMAIVTGRNKR
SLEDYFDTSYEIEHQIQGTNKENALKSIRNIIEKCCFSYVRQKQMKGLGHAILTGEALIG
NEPFAVILADDLCISHDHPSVLKQMISLYQKYQCSIVAIEEVALEEVSKYGVIRGEWLEE
GVYEIKDMVEKPSQEDAPSNLAVIGRYILTPDIFEILSETKPGKNNEIQITDALLTQAKR
KRIIAYQFKGKRYDCGSVEGYIEASNAYYKKRL
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaaaatgcctttttcctgccgctggctacggcacgcgctttttgccgatcact
aaaaccattcctaaagaaatgttgcccattgtggataagcctttaatccaatacgctgta
gaagaagcgatggaggcaggctgtgaagtgatggcgatcgttacaggaagaaacaagcgc
agtttagaagattattttgacacaagctatgaaatagagcatcaaatccaaggcactaac
aaagaaaacgccctaaaaagcattcgtaacattatagaaaaatgctgtttttcctatgtg
cgccaaaagcaaatgaaaggcttagggcatgcgattttaaccggagaagccctcataggc
aatgagccttttgcggtgattttagccgacgatttatgcataagccatgatcacccaagc
gtgctaaagcaaatgatttcattgtatcaaaaataccaatgttccattgtagccattgaa
gaagtggcgctagaagaagtttcaaaatacggcgtgattaggggcgaatggttagaagag
ggggtgtatgagattaaagacatggtggaaaaaccaagccaagaagacgccccaagcaat
ctggccgtgatagggcgctacattctaaccccggatatttttgaaattttaagcgagacg
aaaccgggcaaaaacaatgaaatccaaatcacagacgccttactcactcaagccaaaaga
aaacggatcatcgcttaccaattcaaaggcaaacgatacgattgcgggagcgtggaaggc
tatattgaagcgagtaacgcttattataaaaaacgcttgtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system