KEGG   Helicobacter pylori Puno135: HPPN135_03200Help
Entry
HPPN135_03200     CDS       T01920                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
heu  Helicobacter pylori Puno135
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:heu00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    HPPN135_03200
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    HPPN135_03200
Enzymes [BR:heu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     HPPN135_03200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
648060..649328
Genome map
AA seq 422 aa AA seqDB search
MDFLEIVGQVPLKGGVEISGAKNSALPILAATLLSQQEVKIKSLPQVVDIKAMALLLQNL
GASLEWLDPNTLQISAKSLHHTEATYDLVRKMRASILVLGPLLARFKECLVSLPGGCAIG
ARPVDLHLKAMQQLGAEIKIEQGYIHAKAPKGLKGNDILFDKISVTGTENALMAASLAKG
ITRIINAAKEPEITQLCAFLQSGGVEIEGVGSSELKIRGVENDALNLKGIQIIPDRIEAG
TYLCVGAITNSQLKINRIIPNHLQAITDKLIEIGFSLDIQENSIEIYPAQKRQAFEITTK
EYPGFPTDMQAQFMALATQCLGTSVIEETLFENRFMHASELQRLGANISLKTNIATISGS
TELTGSDVMATDLRASSALILAALVAKGVSRVHRIYHLDRGYERLEDKINALGAKVVRLK
EK
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
ttggattttttagagattgtaggacaagtccctttaaaagggggggtagaaatttcaggg
gcgaaaaactccgcgctccccattttagccgccacgcttttaagccaacaggaagtcaaa
atcaaatctttgccccaagtggtggatataaaggcgatggcgttattgttgcaaaattta
ggcgcaagcttagaatggcttgatcctaacacgcttcaaatcagcgccaaatccttgcac
cacaccgaagccacttacgatttggtgcgtaaaatgcgcgcttccattttggttttaggc
ccactattagcgcgttttaaagaatgcttggtgagtttgcccggtgggtgcgctatagga
gcaaggcctgtggatttgcacttaaaagcgatgcaacaattaggggctgaaatcaaaatt
gagcaaggctatatccatgcaaaagcccctaaaggcttgaaagggaatgatattttattt
gataaaatcagcgttacaggcacagaaaacgccctcatggccgcaagcttagctaaaggg
atcacgcgcatcattaacgccgctaaagagccagaaatcactcaattgtgcgcgttttta
cagagtgggggggtagaaattgagggcgttggcagcagcgagttaaagattaggggggta
gaaaatgacgctttaaatttaaaaggcattcaaatcatacccgataggattgaagcaggc
acttatttatgcgtgggggctatcactaacagccagcttaaaatcaatcgcatcatccct
aaccatcttcaagcgatcactgacaagctcatagaaattggtttttcgctagacattcaa
gaaaattctatagaaatttatccggcccaaaaacgccaagcctttgaaatcaccacgaaa
gaatacccgggctttcccacagacatgcaagcgcaattcatggcgttagccacgcagtgt
ttggggacgagtgtgattgaagagacgctttttgaaaaccgcttcatgcatgcaagcgaa
ttgcaacgcttgggggctaatatcagcctaaaaaccaatatcgctaccattagcggatcc
acagagcttaccggaagcgatgtgatggcgaccgatttaagggcttcttcggctctcatt
ttagccgctttagtggctaagggcgtgagtagggtgcataggatttatcacttggataga
ggttatgagagattagaggataaaatcaacgccttaggggcaaaagttgtgcgcttaaaa
gaaaaataa

DBGET integrated database retrieval system