KEGG   Helicobacter pylori Puno135: HPPN135_05570Help
Entry
HPPN135_05570     CDS       T01920                                 

Gene name
pcm
Definition
protein-L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
heu  Helicobacter pylori Puno135
Brite
Enzymes [BR:heu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     HPPN135_05570 (pcm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1140028..1140657
Genome map
AA seq 209 aa AA seqDB search
MNSIKNHLMCEEINKRFSLHPKVREAMESIEREVFVPAPFKHFAYTLNALSMQAQQYISS
PLTVAKMTQYLEIDHVDSVLEIGCGSGYQAAVLSQIFRRVFSIERIESLYIEARLRLKTL
GLNNVHVKFADGNKGWDQYAPYDRILFSACAKNIPQALIDQLEEGGILVAPIQENNEQVI
KRFVKQNNALRVQKVLEKCLFVPVVDGVQ
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
ttgaatagtattaaaaaccatttgatgtgtgaagaaatcaataagcgtttcagtttgcac
cccaaagtgagagaggctatggagagcattgaaagggaggtttttgtgccagcccccttt
aaacattttgcttacactttaaacgcgctttctatgcaagcgcaacaatacatttcttcg
cccctaaccgtggccaaaatgacgcaatatttagaaattgatcatgtggatagcgtgcta
gaaattggctgcgggagcggctatcaagcggcggttttgtctcaaattttcaggcgcgtt
tttagcattgaaaggattgaaagcttgtatatagaagcgcgtttgcgccttaaaactctc
ggtttaaacaacgttcatgttaaattcgctgatgggaataagggctgggatcaatacgct
ccctatgataggattttgttctctgcttgcgctaaaaatatccctcaagcgctgattgat
cagcttgaagaaggcgggatattagttgcgcccattcaagaaaataacgagcaagtgatc
aaacgctttgtgaagcaaaataacgccttgcgcgtccaaaaagtgttagaaaaatgcttg
tttgtgcctgttgtagatggggtgcaataa

DBGET integrated database retrieval system