KEGG   Helicobacter pylori Puno135: HPPN135_05630Help
Entry
HPPN135_05630     CDS       T01920                                 

Gene name
glk
Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
heu  Helicobacter pylori Puno135
Pathway
heu00010  Glycolysis / Gluconeogenesis
heu00052  Galactose metabolism
heu00500  Starch and sucrose metabolism
heu00520  Amino sugar and nucleotide sugar metabolism
heu00521  Streptomycin biosynthesis
heu01100  Metabolic pathways
heu01110  Biosynthesis of secondary metabolites
heu01120  Microbial metabolism in diverse environments
heu01130  Biosynthesis of antibiotics
heu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:heu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HPPN135_05630 (glk)
   00052 Galactose metabolism
    HPPN135_05630 (glk)
   00500 Starch and sucrose metabolism
    HPPN135_05630 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    HPPN135_05630 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    HPPN135_05630 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    HPPN135_05630 (glk)
Enzymes [BR:heu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     HPPN135_05630 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase
Motif
Other DBs
NCBI-ProteinID: AEN18791
UniProt: G2MAA5
Position
1151926..1152936
Genome map
AA seq 336 aa AA seqDB search
MPKTETYPRLLADIGGTNARFGLEVAPRQIECIEVLPCEDFESLSDAVRFYLSKCKESLK
LHPIYGSFAVATPIMGDFVQMTNNHWTFSIETTRQCLDLKKLLVINDFVAQAYAISAMQE
NDLAQIGGIKCEINAPKAILGPGTGLGVSTLIQNSDGSLKVLPGEGGHVSFAPFDDLEIL
VWQYARSKFNHVSAERFLSGSGLVLIYEALSKRKGLEKVAKLSKAELTPQIISERALNGD
YPICRLTLDTFCSMLGTLAADVALTLGARGGVYLCGGIIPRFIDYFKTSPFRARFETKGR
MGAFLASIPVHVVLKKTPGLDGAGIALENYLLHDKI
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaaactgaaacttacccaagactattagccgatattggtggcacgaacgcgcgc
tttggcttggaagtcgccccacgacagattgaatgcattgaagttttgccatgcgaagat
tttgaaagtttgagcgatgcggtgcgattttacctttctaaatgcaaagaaagccttaaa
ctgcaccctatttatggctcttttgcggtggctacgcccattatgggggattttgtccaa
atgactaacaaccactggactttttctattgaaacgacacggcaatgtttggatttaaaa
aaattgcttgtcatcaacgattttgtcgcgcaagcctatgccattagcgcgatgcaagaa
aacgatctggctcaaataggcgggattaagtgcgaaatcaacgctcctaaagcgatttta
gggccaggaactgggcttggggtaagcactcttatccaaaacagcgacggctctttaaaa
gtcttgcccggtgaaggggggcatgtgagcttcgccccttttgatgatttagaaatttta
gtgtggcaatacgcccgctctaaattcaatcatgtgagcgcggaaaggtttttgagcggg
agcggtttggtgttgatttatgaggccctgtctaaacgcaaaggcttagaaaaagtggcg
aagttaagcaaggctgaattaaccccacaaatcattagcgaacgcgctttgaatggggat
taccctatatgccgattgactttggacactttttgctccatgctaggcacgctcgctgct
gatgtggctctcactttgggggctagggggggcgtgtatttgtgtggggggattatccca
cgattcattgattattttaaaacttcgccctttagagcgcgttttgaaacgaaagggcgc
atgggagcgtttctcgcttctatccctgtgcatgtcgtgctgaaaaaaaccccgggactt
gatggggcaggcattgcgttagagaattatttactgcatgataagatatag

DBGET integrated database retrieval system