KEGG   Helicobacter pylori Puno135: HPPN135_05665Help
Entry
HPPN135_05665     CDS       T01920                                 

Definition
(GenBank) pyruvate flavodoxin oxidoreductase subunit gamma
  KO
K00172  pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
heu  Helicobacter pylori Puno135
Pathway
heu00010  Glycolysis / Gluconeogenesis
heu00020  Citrate cycle (TCA cycle)
heu00620  Pyruvate metabolism
heu00640  Propanoate metabolism
heu00650  Butanoate metabolism
heu00680  Methane metabolism
heu01100  Metabolic pathways
heu01120  Microbial metabolism in diverse environments
heu01130  Biosynthesis of antibiotics
heu01200  Carbon metabolism
Module
heu_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:heu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HPPN135_05665
   00020 Citrate cycle (TCA cycle)
    HPPN135_05665
   00620 Pyruvate metabolism
    HPPN135_05665
   00640 Propanoate metabolism
    HPPN135_05665
   00650 Butanoate metabolism
    HPPN135_05665
  Energy metabolism
   00680 Methane metabolism
    HPPN135_05665
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    HPPN135_05665
Enzymes [BR:heu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     HPPN135_05665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR MAF_flag10
Motif
Other DBs
NCBI-ProteinID: AEN18798
UniProt: G2MAB2
Position
1159081..1159641
Genome map
AA seq 186 aa AA seqDB search
MFQIRWHARAGQGAITGAKGLADVISKTGKEVQAFASYGSAKRGAAMMAYNRIDDEPILN
HERFMEPDYVLVIDPGLVFIENIFANEKEDTTYIITSYLNKEELFEKKPELKTRKVFLVD
CLKISMETLKRPIPNTPMLGALMKVSGMLEIGAFKEAFKKVLGKKLTQEVIDANMLAIQR
AYEEVQ
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgtttcaaattagatggcatgcacgagcgggtcaaggcgctatcaccggcgctaagggg
ttggctgatgtgatttcaaaaacaggcaaagaagtgcaagcgttcgcttcctatggttca
gctaaaaggggggctgctatgatggcttataaccgcattgatgatgagcctattttaaac
catgaacgcttcatggagcctgattatgtgctggtgattgatccgggtttggttttcatt
gaaaacatcttcgctaatgaaaaagaagacacgacctatatcatcactagttatcttaac
aaagaagaattgtttgaaaaaaaacctgaattaaaaacccgtaaggtgtttttagtggat
tgtttaaaaatctctatggaaaccttaaaacgccccatccccaacacgcccatgctaggg
gcgttaatgaaagtgtctggcatgcttgaaattggggcttttaaagaagcttttaagaaa
gttttgggcaaaaaactcacgcaagaagtcattgacgctaacatgctcgctatccaaaga
gcttatgaagaagttcaataa

DBGET integrated database retrieval system