KEGG   Helicobacter pylori Puno135: HPPN135_06315Help
Entry
HPPN135_06315     CDS       T01920                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
heu  Helicobacter pylori Puno135
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:heu00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1294327..1295469
Genome map
AA seq 380 aa AA seqDB search
MILKRLNPDALKNALLKTGSEKCAQTHMHKKGVSFVFEIQHLPLSATLILKQEAISVGGD
FATPRDCILAKEPFYDGVLIVSASQLERLIVKCHSQPFGLKNLAQELKSHLKSKKPNNPQ
IMAILNLTPDSFYEKSRFDSKKALEEIYQLLEKGITLIDIGAASSRPQSEIIDPKIEQDR
LKEVLLEIKSQKLYQCAKFSIDTYHATTAQMALEHYFSILNDVSGFSSIGMLEVARDYKP
TCILMHAQKTPKDMQENVFYHNLFDEMDRFFKEKLEVLEKYALQDIILDIGFGFAKLKEH
NLALIKHLSHFLKFKKPLLVGASRKNTIGLITGREVQNRLAGTLSLHLMALQNGASILRV
HDIDEHIDLIKVFKSLEETN
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgattttaaaacgccttaaccctgatgcactcaaaaacgcccttttaaaaaccggatca
gaaaagtgcgctcaaacccatatgcataaaaaaggcgttagctttgtttttgaaatccaa
catctgcccttaagcgcaacgctcattttaaaacaagaggccatcagcgttgggggcgat
ttcgccacgccaagagattgtattttagctaaagagcctttttatgatggggtgttgatt
gtgagcgctagccagttagaacgccttattgtcaagtgccattcccaaccctttgggctt
aaaaatttagcgcaagaattaaaaagccaccttaaatccaaaaagcctaacaacccacag
atcatggcaattttgaatctcacgccggatagcttctatgaaaaaagccgttttgatagc
aaaaaagcgcttgaagaaatctatcaattattagaaaagggtatcacgctcattgatata
ggcgcagccagttcaaggccacagagtgaaatcattgatccaaaaatagagcaagatcgc
ttaaaagaagttttattagaaatcaaatcccaaaaactctaccaatgcgctaaattcagt
atagacacctaccatgccacaaccgcccaaatggctttggagcattatttttccatcctt
aatgatgtgagcggttttagtagtattggaatgctagaagtcgctagagattacaaaccc
acttgcattttaatgcacgctcaaaaaacccccaaagacatgcaagaaaatgttttttac
cacaatttatttgatgaaatggatcgcttctttaaggaaaaactagaggttttagaaaaa
tacgcgcttcaagatattattttagatatagggtttgggttcgctaaattaaaagagcat
aatttagccttaatcaagcatttaagccacttcctcaaattcaaaaaacccttattggtg
ggagcgagtcgtaaaaacacgatcgggcttatcaccgggcgtgaagttcaaaaccggctc
gccggcactttaagcttgcatttaatggcgttacaaaatggagcgagcattttaagagtg
catgacattgatgagcatatagatctcatcaaggtgtttaagagtttagaagaaacaaat
tga

DBGET integrated database retrieval system