KEGG   Helicobacter pylori Puno135: HPPN135_06550Help
Entry
HPPN135_06550     CDS       T01920                                 

Definition
phosphomannomutase
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
heu  Helicobacter pylori Puno135
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:heu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HPPN135_06550
   00030 Pentose phosphate pathway
    HPPN135_06550
   00051 Fructose and mannose metabolism
    HPPN135_06550
   00052 Galactose metabolism
    HPPN135_06550
   00500 Starch and sucrose metabolism
    HPPN135_06550
   00520 Amino sugar and nucleotide sugar metabolism
    HPPN135_06550
  Nucleotide metabolism
   00230 Purine metabolism
    HPPN135_06550
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    HPPN135_06550
Enzymes [BR:heu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     HPPN135_06550
    5.4.2.8  phosphomannomutase
     HPPN135_06550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1339151..1340527
Genome map
AA seq 458 aa AA seqDB search
MDISIFREYDIRGIYPTTLDEKGAFSIGVELGKIMREYDKSVFVGHDARVHGRSLFEALS
AGLQSSGLKVYDLGLIPTPVAYFAAFNEIDNIQCPNSIMITGSHNPKEYNGFKITLNQNP
FYGKDIQALKDTLLNAKHEIKPLKETPKKANALESYQRYLIKDFEHLKNLKYKIALDFGN
GVGALGLEPILKALNIDFCSLYGDPDGNFPNHHPDPSEAKNLKDLEKHMQENAISIGFAF
DGDADRIAMLSSHHVYAGDELAILFAKRLHAQGITPFVIGEVKCSQVMYNTINAFGKTLM
YKTGHSNLKIKLKETHAHFAAEMSGHIFFKERYFGYDDALYACLRALELLLEQTPSDLEN
TIKNLPYSYTTPEEKIAVIEEEKFEIIHNLQEALKNPPNNFPKIKEIISIDGVRVVFEHG
FGLIRASNTTPYLVSRFEGKDETTALEYKKALLNLLEK
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atggacattagcatttttagagaatatgatattagaggcatttaccccaccactttagat
gagaaaggggcttttagtatcggcgtggagttagggaaaatcatgcgagaatacgataaa
agcgtgtttgtagggcatgacgccagggtgcatgggcgatcgctttttgaagctttgagc
gcggggttacaatcaagcggcttgaaagtgtatgatttagggctaatccccacaccggta
gcgtattttgcggcctttaatgaaatagacaatatccaatgccccaattccatcatgatc
accggttctcacaaccccaaagaatacaacggctttaaaatcacgctcaatcaaaacccg
ttttatggcaaggacattcaagctttaaaagacacgcttttaaacgccaagcatgaaata
aaacccctaaaagaaacaccaaagaaagccaatgccctagaatcgtatcagcgctatttg
atcaaggattttgagcatttaaaaaaccttaaatacaaaatcgccctggattttggtaat
ggcgtgggagcgttaggcttagagcctattttaaaggctttaaacattgatttttgcagc
ctttatggcgatcctgatgggaattttcctaaccaccacccagaccctagcgaagcgaaa
aacttaaaagacttagaaaaacacatgcaagaaaacgctatttctataggctttgctttt
gatggcgatgcggacaggattgcgatgttaagctctcatcatgtttatgcgggcgatgaa
ttagcgattttattcgctaaacgcttgcatgctcaaggcatcaccccctttgtgatcggc
gaagtcaaatgctctcaagtgatgtataacacgatcaatgcttttggtaagacgctcatg
tataaaaccgggcatagcaatttaaaaatcaaactcaaagaaacccatgcgcattttgcg
gctgaaatgagcgggcatatcttttttaaagagcgctattttggctatgatgacgctctt
tatgcatgcttaagggctttagaattattgcttgaacaaaccccaagcgatttggaaaac
accattaaaaatctcccctattcctacaccacgcctgaagaaaaaatcgccgtgatcgaa
gaagaaaaatttgaaatcattcataacctgcaagaagcgcttaaaaacccgccaaataat
ttccctaaaatcaaagaaataatcagcattgatggcgtgagggtggtttttgaacatggt
tttgggcttattcgcgcaagcaacaccactccgtatttagtcagccgctttgaaggcaag
gatgaaacaacggcgttagagtataaaaaagcactactcaatttgctagagaaataa

DBGET integrated database retrieval system