KEGG   Helicobacter pylori Puno135: HPPN135_06560Help
Entry
HPPN135_06560     CDS       T01920                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase subunit alpha (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
heu  Helicobacter pylori Puno135
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:heu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HPPN135_06560 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HPPN135_06560 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HPPN135_06560 (trpA)
Enzymes [BR:heu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HPPN135_06560 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1341153..1341941)
Genome map
AA seq 262 aa AA seqDB search
MRYKNMFETLKKQDKMAFIPFVTLGDPNYEWSFEIIKTLIASGVSALELGFAFSDPVADG
ITIQASHLRALKHAAMGKNFQLLRAIRDYNPHIPIGLLAYANLIFSYGVDNFYAQIKECG
VDSVLIADMPLIEKELVLKSAQKHQIKQIFIASPNASSKDLEQVAMHSQGYIYTLARSGV
TGVSRILENDASAIIKTLKTFSPTPTLLGFGISKKEHIKNAKGMGADGVICGSALVKIIE
ENLNDENAMLEKIKRFVGEMIF
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgaggtataaaaacatgtttgaaaccttaaaaaaacaagacaaaatggcgtttatccca
tttgtaaccttgggcgatcctaattatgaatggagctttgaaatcattaaaactttaatt
gctagcggggtgagcgctttagaattgggctttgctttctcagatccggtagcggatggc
attaccatacaagcgagccatttaagggcgttaaaacacgctgctatgggaaaaaatttc
cagcttttaagggcgattagagattacaacccccacattcccatagggcttttagcgtat
gcgaatctcattttttcttatggcgtggataatttttacgcccaaatcaaagaatgcggc
gtggatagcgttttaatagcggacatgcccctaatagaaaaagaattagtcctaaaatcc
gctcaaaaacaccaaattaaacaaatctttatcgccagccccaatgcgagcagtaaagat
ttagaacaagtcgctatgcattcgcaaggctatatctacactctggctaggagtggggtt
acaggggtgagccgtattttagaaaatgatgcgagtgctattattaaaaccctaaaaact
tttagccccacaccgaccttattgggctttggcatttctaaaaaagaacacataaaaaac
gctaaaggcatgggcgctgatggcgtgatttgcggctcagcgttggtcaaaatcatagaa
gaaaatttgaacgatgaaaacgccatgctagaaaaaattaaaaggtttgtaggagaaatg
attttttaa

DBGET integrated database retrieval system