KEGG   Helicobacter pylori Puno135: HPPN135_06565Help
Entry
HPPN135_06565     CDS       T01920                                 

Definition
(GenBank) tryptophan synthase subunit beta
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
heu  Helicobacter pylori Puno135
Pathway
heu00260  Glycine, serine and threonine metabolism
heu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
heu01100  Metabolic pathways
heu01110  Biosynthesis of secondary metabolites
heu01130  Biosynthesis of antibiotics
heu01230  Biosynthesis of amino acids
Module
heu_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:heu00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HPPN135_06565
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HPPN135_06565
Enzymes [BR:heu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HPPN135_06565
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AEN18976
UniProt: G2MAU0
Position
complement(1341931..1343118)
Genome map
AA seq 395 aa AA seqDB search
MNKKAYFGEFGGSFVSELLVPALRELEQAFDACLKDEKFQKEYSHLLKDFVGRPSPLTLC
QNIVSNPKVKLYLKREDLIHGGAHKTNQALGQALLAKKMGKTRIIAETGAGQHGVATAIA
CTLLGLKCVIFMGAKDIKRQEMNVFRMRLLGAEIREVNSGSATLKDAVNEALRDWASSYK
DTHYLLGTAAGPHPYPTMVKTFQKMIGDEVKSQILEKENRLPDYVIACVGGGSNAIGIFS
AFLNDKEVKLIGVEPAGLGLETNKHGATLNKGRVGILHGNKTYLLQDDEGQIIESHSISA
GLDYPGVGPEHSYLKESARAIYKSASDLEALEAFSLLCQKEGIIPALESSHALAYALKLA
QKCEEESIIVVNLSGRGDKDLSTVYNALKGVLNEV
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaaaagcgtattttggggagtttggagggagttttgtttcagaattgttagtg
cctgcattaagagaattagaacaggcgtttgatgcgtgtttgaaagatgaaaaattccaa
aaagaatattcccatcttttaaaagattttgtgggccgtcctagccccttaaccttgtgt
caaaatatcgtttctaaccctaaagttaagctttatctaaaacgagaagatttaatccat
ggcggggcgcataagactaatcaggctttagggcaagcccttttagcgaaaaaaatgggt
aaaacaaggattattgctgaaacaggtgctgggcagcatggcgtggcgacggctatcgct
tgcacgttattgggtttaaaatgcgtgatttttatgggggctaaagacatcaagcgccag
gaaatgaacgtttttagaatgcgcttattaggcgctgaaatcagagaggttaattcaggg
agcgcgacgcttaaagacgctgtgaatgaagctttaagggattgggcgagcagttacaag
gacacgcattatctgctaggcacagccgctgggccacacccttaccccacaatggttaaa
acctttcaaaaaatgataggcgatgaggttaaaagccaaattttagaaaaagaaaaccgc
ttgcctgattatgttatcgcatgcgttggaggggggtctaacgctatagggatatttagc
gcgtttttaaacgataaagaggttaaactcataggcgtagagccggcgggtttagggcta
gaaaccaataagcatggggcgactttgaataaggggcgtgtggggattttgcatgggaat
aaaacctatcttttacaagatgatgaaggccagattatagaaagccatagcattagcgcc
gggcttgattatccaggagtggggccagaacacagctatttaaaagagagcgctcgcgcg
atttataaaagcgcaagcgatcttgaagcgctagaagcctttagtttgttgtgccaaaaa
gaaggcattatcccagcgctagaaagctcacacgccttagcgtatgccttaaaactcgct
caaaaatgcgaagaggaaagcatcattgtagtgaatttaagcggtcgtggggataaggat
ttaagcaccgtttataacgctttaaaaggggttttaaatgaggtataa

DBGET integrated database retrieval system