KEGG   Helicobacter pylori Puno135: HPPN135_06570Help
Entry
HPPN135_06570     CDS       T01920                                 

Definition
(GenBank) bifunctional indole-3-glycerol phosphate synthase/phosphoribosylanthranilate isomerase
  KO
K13498  indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
heu  Helicobacter pylori Puno135
Pathway
heu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
heu01100  Metabolic pathways
heu01110  Biosynthesis of secondary metabolites
heu01130  Biosynthesis of antibiotics
heu01230  Biosynthesis of amino acids
Module
heu_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:heu00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HPPN135_06570
Enzymes [BR:heu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     HPPN135_06570
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     HPPN135_06570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS PRAI QRPTase_C
Motif
Other DBs
NCBI-ProteinID: AEN18977
UniProt: G2MAU1
Position
complement(1343120..1344478)
Genome map
AA seq 452 aa AA seqDB search
MPSVLENILKDKLLEVSMLKKNHALPTNINPSDRDFKKALLEKKTSFILECKKASPSKGL
IRKDFDLLKIAKTYEKFASCISVLADSKYFLGSYENIKIVSQHSIKPILCKDFIIDAFQI
KLARMMGANAVLLMLSVLDDKNYLELFNLAKSLNMSVLTEVSNQQEIKRLLKLQYDIIGI
NNRDLHTLKTDINHTLKLRPLLPKDALVVSESGIYSHTQIKALAPYVNGFLVGSSLMKEK
DLKKACIKLILGENKVCGLTRIKDAKAVYKNHFIYGGLIFEKSSPRYIKPKEALKITKAV
KKLDFVGVFVKDRIKKIQKIAKKLDLKAVQLYGYSQQEIAQLKKSLPKTCTIWQVGSVMN
ANDLAPKVKEASLILYDTKGDKMGGNGVSFDWGILENVKTPFMLAGGLNLDNIQKALKVK
ALGLDFNSGLETSPGIKNKDKIKRLARILREY
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgcctagcgtgttagaaaacatccttaaagacaagctcctagaagtttctatgctcaaa
aaaaaccacgctttaccaacaaacataaacccaagcgatagggattttaaaaaggcgtta
ctagaaaaaaagaccagctttattttagaatgcaaaaaagcatcgccctctaaaggttta
atcagaaaagattttgatctgttgaaaatagccaagacttatgaaaaattcgcctcttgc
atttcggttttagccgattctaaatattttttaggctcttatgaaaacattaagattgtt
tcgcaacattccattaagcccattttatgcaaagattttatcattgatgcttttcaaatc
aaactcgctagaatgatgggggctaatgcggtgcttttaatgttaagcgtattagacgat
aagaattatttagagctttttaacctcgctaaatccttaaacatgagcgtgctgactgaa
gtttccaaccagcaagaaatcaagcgcttgctcaaactccaatacgacattatcggcatc
aataacagggatttacacaccttaaaaaccgacattaaccacacgctcaaattgcgcccc
cttttgcctaaagacgcgctcgtggtgagtgagtccggtatttattcgcacacgcaaatc
aaagccctagccccttatgtgaatggctttttagtgggcagctctttaatgaaagaaaag
gatttgaaaaaagcgtgtattaaattgattttaggcgaaaataaagtgtgcgggcttaca
agaattaaagacgctaaagccgtttataaaaaccattttatttatgggggtttgattttt
gaaaaatcttcgcccagatacatcaagcctaaagaagccctaaaaatcacaaaagcggtt
aaaaaattggattttgtgggcgtgtttgtgaaagataggattaagaaaattcaaaaaatc
gctaaaaagcttgatttaaaagcggtgcaactttatggctattcgcaacaagaaatcgct
caattaaaaaaatcgctccctaaaacttgcacgatttggcaagtagggagcgtgatgaac
gctaacgatttagcgcctaaagttaaagaagcctctctaatcttatacgacactaagggg
gataaaatgggaggcaatggcgtgagttttgattggggcattttagaaaatgtcaaaacg
cctttcatgttagctggcgggcttaatttggataatattcaaaaagctttgaaggttaaa
gcgttgggtttggatttcaattcaggtttagaaacaagccccgggattaaaaataaggat
aaaatcaagcgattagcccgaattttaagagagtattaa

DBGET integrated database retrieval system