KEGG   Helicobacter pylori Puno135: HPPN135_07290Help
Entry
HPPN135_07290     CDS       T01920                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
heu  Helicobacter pylori Puno135
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:heu00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1472983..1473786
Genome map
AA seq 267 aa AA seqDB search
MHAFEVYPKVNIFLKILHKEGAYHKLISRMCLVKDRFKDIISVKSTLSFSLKGDFDCPLE
ENSLFKALQILKNFLKSKNFSHSAIKSLDTLAIEVEKNIPTQAGLGGGSADAGGLLYHLN
QIFDWRLSLEELYSMGSLVGADTNFFISQHKSANATSYGEVIENFEEEPLENRLEIYTPN
HVFCSTKAIYQAYKPETCFSQAKEWLKKPSLECLKTCDRNELNDLLKPALLTNQALRGIE
SELGKEWFFSGSGSAFFRLKPALKGGE
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgcatgcttttgaagtttatcctaaagtcaatatttttttaaaaatccttcacaaagaa
ggggcttaccataagctcatttctcgcatgtgtttggtcaaagatagattcaaagatatt
atcagcgtcaaaagcacgctttccttttcgctaaaaggggattttgactgccctttagaa
gaaaactcgctctttaaagccctccaaattttaaaaaattttttaaaatcaaaaaatttc
tctcattctgccatcaaatccctagacaccctagcgattgaagtggaaaaaaacatcccc
actcaagccgggttaggcggtgggagcgctgatgctggggggctattgtatcatttgaat
caaatttttgactggcgtttgagtttagaagaactttacagcatgggatctttagtgggt
gcagacaccaattttttcatctcgcaacacaaaagcgctaacgccacttcttatggcgaa
gttattgaaaattttgaagaagagcctttagaaaatcgcctagaaatctatacgccaaac
catgttttttgcagcaccaaagccatttatcaagcctataaacctgaaacttgtttttct
caagctaaagagtggcttaaaaagccgagtttagaatgtctaaagacttgcgacagaaac
gaattaaacgatcttttaaagccggctttactcactaaccaagccttaagaggtatagaa
agcgaactgggcaaggagtggttttttagcgggagcgggagcgcgttttttaggctaaag
cctgcgttaaaagggggcgaatga

DBGET integrated database retrieval system