KEGG   Helicobacter pylori Puno135: HPPN135_07290Help
Entry
HPPN135_07290     CDS       T01920                                 

Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
heu  Helicobacter pylori Puno135
Pathway
heu00900  Terpenoid backbone biosynthesis
heu01100  Metabolic pathways
heu01110  Biosynthesis of secondary metabolites
heu01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:heu00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HPPN135_07290
Enzymes [BR:heu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     HPPN135_07290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N
Motif
Other DBs
NCBI-ProteinID: AEN19119
UniProt: G2MB83
Position
1472983..1473786
Genome map
AA seq 267 aa AA seqDB search
MHAFEVYPKVNIFLKILHKEGAYHKLISRMCLVKDRFKDIISVKSTLSFSLKGDFDCPLE
ENSLFKALQILKNFLKSKNFSHSAIKSLDTLAIEVEKNIPTQAGLGGGSADAGGLLYHLN
QIFDWRLSLEELYSMGSLVGADTNFFISQHKSANATSYGEVIENFEEEPLENRLEIYTPN
HVFCSTKAIYQAYKPETCFSQAKEWLKKPSLECLKTCDRNELNDLLKPALLTNQALRGIE
SELGKEWFFSGSGSAFFRLKPALKGGE
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgcatgcttttgaagtttatcctaaagtcaatatttttttaaaaatccttcacaaagaa
ggggcttaccataagctcatttctcgcatgtgtttggtcaaagatagattcaaagatatt
atcagcgtcaaaagcacgctttccttttcgctaaaaggggattttgactgccctttagaa
gaaaactcgctctttaaagccctccaaattttaaaaaattttttaaaatcaaaaaatttc
tctcattctgccatcaaatccctagacaccctagcgattgaagtggaaaaaaacatcccc
actcaagccgggttaggcggtgggagcgctgatgctggggggctattgtatcatttgaat
caaatttttgactggcgtttgagtttagaagaactttacagcatgggatctttagtgggt
gcagacaccaattttttcatctcgcaacacaaaagcgctaacgccacttcttatggcgaa
gttattgaaaattttgaagaagagcctttagaaaatcgcctagaaatctatacgccaaac
catgttttttgcagcaccaaagccatttatcaagcctataaacctgaaacttgtttttct
caagctaaagagtggcttaaaaagccgagtttagaatgtctaaagacttgcgacagaaac
gaattaaacgatcttttaaagccggctttactcactaaccaagccttaagaggtatagaa
agcgaactgggcaaggagtggttttttagcgggagcgggagcgcgttttttaggctaaag
cctgcgttaaaagggggcgaatga

DBGET integrated database retrieval system