KEGG   Helicobacter pylori Puno135: HPPN135_07765Help
Entry
HPPN135_07765     CDS       T01920                                 

Definition
arginase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
heu  Helicobacter pylori Puno135
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:heu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HPPN135_07765
  Amino acid metabolism
   00330 Arginine and proline metabolism
    HPPN135_07765
Enzymes [BR:heu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     HPPN135_07765
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1577387..1578328)
Genome map
AA seq 313 aa AA seqDB search
MILVGLEAELGASKRGTDKGVRRLREALSATHGDVIKGMQTIIQEQCVLYKEFRYAKNFE
DYYLFCKENLIPCMREVFEKKEFPLILSSEHANMFGIFQAFRSVHKDKKIGILYLDAHAD
IHTAYDSDSKHIHGMPLGMVLNRVRSGFNRMNESEEKAWQKLCSLGLEKGGLEIDPKCLV
YFGVRSTEQSERDVIKELQIPLFSVEAIRENMQEVVQKTKESLKAVDIIYLSLDLDIMDG
KLFTSTGVRENNGLSFDELKQLLGLLLESFKDRLRAIEVTEYNPTVSAKHTSEEEKQVLE
ILDLIINSCKIKD
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgattttagtaggattggaagcggaattaggagcgtcaaaaagaggcaccgataaaggg
gttaggcgtttgagagaagctttaagtgcaacgcatggcgatgtgattaaaggcatgcaa
acgatcattcaagagcagtgtgtgctttataaagaatttagatacgctaagaattttgaa
gattactaccttttttgtaaagaaaatttgatcccttgcatgcgagaagtgtttgagaaa
aaagaatttcctttgattttaagctcagagcatgcgaacatgtttgggattttccaagcc
tttaggagcgttcataaggacaaaaaaatagggattttgtatttagacgcgcatgcggat
attcatacggcttatgacagcgattcaaagcatatccacggcatgcctttgggcatggtt
ttaaatcgtgtccgtagcgggttcaatcgcatgaatgagagcgaagaaaaggcatggcaa
aagctctgctctttggggttagaaaagggagggttagaaattgatcctaaatgtttggtg
tattttggggtaagaagcaccgaacagagcgaaagagatgtgattaaggaattgcaaatc
cctttatttagcgtggaagcgataagagaaaacatgcaagaagtggttcaaaaaaccaaa
gaatcattaaaagcggtggatattatttatctcagtttggatctagacattatggatggc
aagcttttcacttctaccggcgtgcgtgaaaataacgggctgagttttgatgagctcaag
caattactgggcttgcttttagaaagctttaaagacagattaagagccattgaggtaacc
gaatacaaccctacggtgagcgcaaaacacactagcgaagaagaaaagcaggttttagag
atattagatctcatcatcaatagctgtaaaattaaagattaa

DBGET integrated database retrieval system